DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and zdhhc20b

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_005162815.2 Gene:zdhhc20b / 100001188 ZFINID:ZDB-GENE-091117-30 Length:409 Species:Danio rerio


Alignment Length:133 Identity:36/133 - (27%)
Similarity:59/133 - (44%) Gaps:27/133 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 FCDHCQMLVPPRSWHCKVCECCILRRDHHCIFTATCVGHTNYRYFFWFTVYMHIGSLLSLATHVN 170
            :||.||::.|.|..||..|:.|:|:.||||.:...|||.:||::|..|..|..:..|...|:   
Zfish   156 YCDRCQVIKPDRCHHCSACDMCVLKMDHHCPWVNNCVGFSNYKFFILFLTYSLVYCLFIAAS--- 217

  Fly   171 LLIIDEQIRRQYVVLHFSRFFLFLKPMSCE----------LIALNISFIINIYA--CILSLIMLG 223
                        |:.:|.:|:...:..|.|          ....::.|:..:.|  ||..|.:..
Zfish   218 ------------VLQYFIKFWTLCRRKSAENCPKSDLPESHAKFHVLFLFFVAAMFCISILSLFT 270

  Fly   224 YQI 226
            |.:
Zfish   271 YHL 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 36/133 (27%)
zdhhc20bXP_005162815.2 zf-DHHC 44..342 CDD:327686 36/133 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.