DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and zdhhc22

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_001340992.2 Gene:zdhhc22 / 100000886 ZFINID:ZDB-GENE-131127-476 Length:280 Species:Danio rerio


Alignment Length:218 Identity:63/218 - (28%)
Similarity:95/218 - (43%) Gaps:37/218 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KIVHPSAVGFVLVGTVLFFSVEMFYMLPRIYDTDGLFFKIAWL----MALFIVYNLLGNMLACHR 81
            |:::..|..:....||:.|::......|.|:.:..:....|.|    :.||::.|.|||.:...|
Zfish     9 KLLNTIAPAYFYAATVVTFALHFLLFTPTIFQSSDVTINPAMLAHISIFLFLMGNALGNYIMTIR 73

  Fly    82 NSSAVTSLPKDRQIP-----CPE--EKHLW----HFCDHCQMLVPPRSWHCKVCECCILRRDHHC 135
            |.|...:   :..||     ||:  :.|..    ||              ||||:..||:|||||
Zfish    74 NPSESAN---ETVIPVCSPDCPDRIDAHYLLNGRHF--------------CKVCKKVILKRDHHC 121

  Fly   136 IFTATCVGHTNYRYFFWFTVYMHIGSLLSLATHVNLLIIDEQIRRQYVVLHFSRFFLFLKPMSCE 200
            .||..|:|:.|.|||..|::|.....|.||...|..|.|:..|..:..:.     ||.|.|:|..
Zfish   122 FFTGNCIGNRNMRYFIMFSIYTSSSCLYSLVIGVAYLTIEYSISFENPLT-----FLTLLPLSTG 181

  Fly   201 LIALNISFIINIYACILSLIMLG 223
            ...|.:...:..:..|:..|.||
Zfish   182 YFFLGLISGLQFFLVIMLYIWLG 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 41/128 (32%)
zdhhc22XP_001340992.2 zf-DHHC 105..233 CDD:307600 40/119 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.