DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sinah and TRAF4

DIOPT Version :9

Sequence 1:NP_648927.1 Gene:sinah / 39885 FlyBaseID:FBgn0259794 Length:351 Species:Drosophila melanogaster
Sequence 2:XP_011523806.1 Gene:TRAF4 / 9618 HGNCID:12034 Length:477 Species:Homo sapiens


Alignment Length:129 Identity:32/129 - (24%)
Similarity:49/129 - (37%) Gaps:37/129 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 LECPVCFGYIMPPIMQCPRGHLICSTCRSKLTICPVCRVFMTNIRSLAMEKVASKLIFPCKHSHF 168
            |.||:|...:..|:.....||..|.||                     :::..|:.:|.|...  
Human    16 LLCPLCGKPMREPVQVSTCGHRFCDTC---------------------LQEFLSEGVFKCPED-- 57

  Fly   169 GCRARLSYAEKTKH-------EEDCECR----PYFCPYPDDKCSWQGPLRDVYQHLMSSHENVI 221
              :..|.|| |..|       :.:.|.:    |..|.:.::.|.|.||||.:..||.:...|||
Human    58 --QLPLDYA-KFPHPYPQIYPDPELEVQVLGLPIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVI 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sinahNP_648927.1 zf-C3HC4 106..140 CDD:278524 9/33 (27%)
Sina 147..341 CDD:281181 22/86 (26%)
TRAF4XP_011523806.1 RING 18..55 CDD:238093 11/57 (19%)
zf-TRAF 109..163 CDD:280357 5/10 (50%)
zf-TRAF 217..276 CDD:280357
MATH_TRAF4 315..470 CDD:239750
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.