DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sinah and QDR1

DIOPT Version :9

Sequence 1:NP_648927.1 Gene:sinah / 39885 FlyBaseID:FBgn0259794 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_012146.1 Gene:QDR1 / 854686 SGDID:S000001382 Length:563 Species:Saccharomyces cerevisiae


Alignment Length:299 Identity:56/299 - (18%)
Similarity:100/299 - (33%) Gaps:91/299 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 VAVQSGIVATGPLDTTRSGARDDF--LMALLECPVCFGYIMPPIMQCPRGHLICSTCRSK----- 133
            :|:.|||:.    |.|....|..:  |:|        |:   .::....|.||.:...||     
Yeast   176 IAINSGIMG----DVTTKVERGGYVGLVA--------GF---QVVGTAFGALIGAGLSSKWGWRA 225

  Fly   134 ----LTI-CPVCRVFMTNI-----RSLAMEKVASKLIFPCKHSHFGCRARLSYAEKTKHEEDCEC 188
                |.| ..:|.||.|.:     |:|    |.:..:.|....:......:...:||.|.:|   
Yeast   226 IFWFLAIGSGICLVFSTLLMPETKRTL----VGNGSVTPRSFLNRSLILHVGSVKKTLHLDD--- 283

  Fly   189 RPYFCPYPD-----DKCSWQGPLRDVYQHLMSSHENVITMEGNDIIFLATNVNLEGALDWTMVQS 248
                 |.|:     ....:..||:            ::.:...||:.....:...   .||..|:
Yeast   284 -----PDPETLEPRTSVDFLAPLK------------ILHIREIDILLSIAGLQFS---TWTTHQT 328

  Fly   249 C----HGRHFLLSLEKINLGEDCQQYFTACRMIGSMKDAAEFVYNISLEAYNRTLRWQSKPRSIR 309
            .    ..:.:.||:.||.|          |.:...:....      |:.:..|.|.|..:.|.::
Yeast   329 ALTIVLSKKYNLSVAKIGL----------CFLPAGISTLT------SIISAGRYLNWSYRTRKVK 377

  Fly   310 ENFSSFTNADFLVLNKH------TVELFSEDGNLALNVV 342
            .| ......:..::.|:      ..||...:.:.|.|:|
Yeast   378 YN-RWIKEQELQLMEKYKGDKNKVAELIHSNSHYAFNLV 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sinahNP_648927.1 zf-C3HC4 106..140 CDD:278524 8/43 (19%)
Sina 147..341 CDD:281181 33/213 (15%)
QDR1NP_012146.1 MFS_Tpo1_MDR_like 72..516 CDD:340881 56/299 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S11711
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.