DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sinah and AT1G66620

DIOPT Version :9

Sequence 1:NP_648927.1 Gene:sinah / 39885 FlyBaseID:FBgn0259794 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_176835.1 Gene:AT1G66620 / 842980 AraportID:AT1G66620 Length:313 Species:Arabidopsis thaliana


Alignment Length:305 Identity:86/305 - (28%)
Similarity:142/305 - (46%) Gaps:47/305 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 AGELVPSRRK-----DSV-AVQSGIVATGPLDTTRSGARDDFLMALLECPVCFGYIMPPIMQCPR 122
            :||...||||     .|| :|::|    |.....|||..  |.:.||:||:|...:..||.||..
plant     2 SGEASTSRRKRQRVPSSVESVENG----GGDAVARSGTL--FELDLLDCPICCHALTSPIFQCDN 60

  Fly   123 GHLICSTCRSKL-TICPVCRVFMTNIRSLAMEKVASKLIFPCKHSHFGCRARLSYAEKTKHEEDC 186
            ||:.||:|.:|| ..||.|.:.:.|.||..||:|...::..|.:...||..:.||.::..||:||
plant    61 GHIACSSCCTKLRNKCPSCALPIGNFRSRIMERVVEAVMVTCPNVKHGCTEKFSYGKELIHEKDC 125

  Fly   187 ECRPYFCPYPDDKCSWQGPLRDVYQHLMSSHENVITMEGNDIIFLATNVNLEGALDWTMVQS--- 248
            .....:||.|:  |::.|..:|:|.|...:|.:.....|..        |..||  |..:..   
plant   126 RFALCYCPAPN--CNYSGVYKDLYSHFYVNHYDTWNQIGCG--------NFAGA--WLRISEKIL 178

  Fly   249 --CHGRHFLLSLEKINLGEDCQQYFTACRMIGSMKDAAEFVYNISLE-AY------NRTLRWQSK 304
              .:|:..|::::...  |....|.|    :..:...|..|..:|.| :|      |.|:.::|:
plant   179 VLQYGQGPLIAVQCFK--ETQGMYVT----VNCIAPCAPGVGELSFELSYKMPMGGNSTMMFKSE 237

  Fly   305 PRSIRENFSSFT-NADFLVLNKHTVELFSEDGNLALNVVIRKVEE 348
            ..:..:..|..| ..||:::..:.:..||   .|.:.:.|||:::
plant   238 EMNRIQKVSFQTPEKDFMLVPYYFLGDFS---TLKMEICIRKLKK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sinahNP_648927.1 zf-C3HC4 106..140 CDD:278524 16/34 (47%)
Sina 147..341 CDD:281181 48/206 (23%)
AT1G66620NP_176835.1 Sina 87..>163 CDD:302762 23/77 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.