DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sinah and AT5G53360

DIOPT Version :9

Sequence 1:NP_648927.1 Gene:sinah / 39885 FlyBaseID:FBgn0259794 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001330825.1 Gene:AT5G53360 / 835417 AraportID:AT5G53360 Length:233 Species:Arabidopsis thaliana


Alignment Length:209 Identity:62/209 - (29%)
Similarity:96/209 - (45%) Gaps:10/209 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 LAMEKVASKLIFPCKHSHFGCRARLSYAEKTKHEEDCECRPYFCPYPDDKCSWQGPLRDVYQHLM 214
            :|:||||..|..|||:.:.||.....|..|.|||..|..|||.|||...:|:..|.:..:..||.
plant    15 IALEKVAESLELPCKYYNLGCLGIFPYYSKLKHESQCNFRPYSCPYAGSECAAVGDITFLVAHLR 79

  Fly   215 SSHENVITMEGNDII---FLATNV-NLEGALDWTMVQSCHGRHFLLSLEKINLGEDCQQYFTACR 275
            ..|:  :.|......   ::.:|. .:|.|.....|..|.|::|.|..|...||. ...|....|
plant    80 DDHK--VDMHTGCTFNHRYVKSNPREVENATWMLTVFQCFGQYFCLHFEAFQLGM-APVYMAFLR 141

  Fly   276 MIGSMKDAAEFVYNISLEAYNRTLRWQSKPRSIRENFSSFTNA-DFLVLNKHTVELFS--EDGNL 337
            .:|...||..:.|::.:....|...|:..|||:|::.....:: |.|::.::....||  :...|
plant   142 FMGDEDDARNYTYSLEVGGSGRKQTWEGTPRSVRDSHRKVRDSHDGLIIQRNMALFFSGGDKKEL 206

  Fly   338 ALNVVIRKVEERTN 351
            .|.|..|..:|:.|
plant   207 KLRVTGRIWKEQQN 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sinahNP_648927.1 zf-C3HC4 106..140 CDD:278524
Sina 147..341 CDD:281181 58/197 (29%)
AT5G53360NP_001330825.1 Sina 15..211 CDD:397316 58/198 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 106 1.000 Domainoid score I2183
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I1644
OMA 1 1.010 - - QHG60089
OrthoDB 1 1.010 - - D780610at2759
OrthoFinder 1 1.000 - - FOG0001170
OrthoInspector 1 1.000 - - mtm1132
orthoMCL 1 0.900 - - OOG6_104798
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X796
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.740

Return to query results.
Submit another query.