DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sinah and AT5G37890

DIOPT Version :9

Sequence 1:NP_648927.1 Gene:sinah / 39885 FlyBaseID:FBgn0259794 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_198605.2 Gene:AT5G37890 / 833768 AraportID:AT5G37890 Length:286 Species:Arabidopsis thaliana


Alignment Length:241 Identity:67/241 - (27%)
Similarity:112/241 - (46%) Gaps:30/241 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RDDFLMAL--LECPVCFGYIMPPIMQCPRGHLICSTCRSKL-TICPVCRVFMTNIRSLAMEKVAS 157
            |...||.|  |:||:|:.....||.||..|||.||:|..|| ..||.|...:.:.|..|||.|..
plant    39 RSTMLMDLEILDCPICYEAFTIPIFQCDNGHLACSSCCPKLNNKCPACTSPVGHNRCRAMESVLE 103

  Fly   158 KLIFPCKHSHFGCRARLSYAEKTKHEEDCECRPYFCPYPDDKCSWQGPLRDVYQHLMSSHENVIT 222
            .::.||.::..||:..:||.::..||::|......||..|  |::....:|:|.|...:|     
plant   104 SILIPCPNAKLGCKKNVSYGKELTHEKECMFSHCACPALD--CNYTSSYKDLYTHYRITH----- 161

  Fly   223 MEGNDI------IFLATNVNLEGALDWTMVQSCHGRHFLLSLEKINLGEDCQQYFTACRMIGSMK 281
            ||.|.|      |.|:..:|:...:   ::::.|..:.|.:::...  |....|.|...:..|..
plant   162 MEINQINTFICDIPLSVRMNISKKI---LIRTEHLTNHLFAVQCFR--EPYGVYVTVSCIAPSSP 221

  Fly   282 DAAEFVYNISLEAYNRTLRWQSKP---------RSIRENFSSFTNA 318
            :.:::.|.:|......|:.:||..         ::.:|||....|:
plant   222 ELSQYSYALSYTVDGHTVIYQSPEVKRVLKLSFQTPQENFMLIPNS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sinahNP_648927.1 zf-C3HC4 106..140 CDD:278524 17/34 (50%)
Sina 147..341 CDD:281181 44/187 (24%)
AT5G37890NP_198605.2 Sina 94..>164 CDD:302762 23/76 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.