DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sinah and SINAT2

DIOPT Version :9

Sequence 1:NP_648927.1 Gene:sinah / 39885 FlyBaseID:FBgn0259794 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001326739.1 Gene:SINAT2 / 824973 AraportID:AT3G58040 Length:308 Species:Arabidopsis thaliana


Alignment Length:236 Identity:87/236 - (36%)
Similarity:124/236 - (52%) Gaps:9/236 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 LLECPVCFGYIMPPIMQCPRGHLICSTCRSKL-TICPVCRVFMTNIRSLAMEKVASKLIFPCKHS 166
            |||||||...:.|||.|||.||.:||.|:.:: ..||.||..:.|||.||:||||..|..||::.
plant    57 LLECPVCTNLMYPPIHQCPNGHTLCSNCKLRVQNTCPTCRYELGNIRCLALEKVAESLEVPCRYQ 121

  Fly   167 HFGCRARLSYAEKTKHEEDCECRPYFCPYPDDKCSWQGPLRDVYQHLMSSHENVITMEGNDII-- 229
            :.||.....|..|.|||:.|..|||.|||...:||..|.:..:..||...|:  :.|......  
plant   122 NLGCHDIFPYYSKLKHEQHCRFRPYTCPYAGSECSVTGDIPTLVVHLKDDHK--VDMHDGCTFNH 184

  Fly   230 -FLATNVN-LEGALDWTMVQSCHGRHFLLSLEKINLGEDCQQYFTACRMIGSMKDAAEFVYNISL 292
             ::.:|.: :|.|.....|.:|.||.|.|..|...||. ...|....|.:|...:|.:|.|::.:
plant   185 RYVKSNPHEVENATWMLTVFNCFGRQFCLHFEAFQLGM-APVYMAFLRFMGDENEAKKFSYSLEV 248

  Fly   293 EAYNRTLRWQSKPRSIRENFSSFTNA-DFLVLNKHTVELFS 332
            .|:.|.|.||..|||||::.....:: |.|::.::....||
plant   249 GAHGRKLTWQGIPRSIRDSHRKVRDSQDGLIIPRNLALYFS 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sinahNP_648927.1 zf-C3HC4 106..140 CDD:278524 17/34 (50%)
Sina 147..341 CDD:281181 64/191 (34%)
SINAT2NP_001326739.1 RING-HC_SIAHs 58..96 CDD:319485 19/37 (51%)
Sina 102..301 CDD:397316 64/191 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 106 1.000 Domainoid score I2183
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I1644
OMA 1 1.010 - - QHG60089
OrthoDB 1 1.010 - - D780610at2759
OrthoFinder 1 1.000 - - FOG0001170
OrthoInspector 1 1.000 - - mtm1132
orthoMCL 1 0.900 - - OOG6_104798
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X796
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.740

Return to query results.
Submit another query.