DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sinah and AT3G13672

DIOPT Version :9

Sequence 1:NP_648927.1 Gene:sinah / 39885 FlyBaseID:FBgn0259794 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001319542.1 Gene:AT3G13672 / 820573 AraportID:AT3G13672 Length:243 Species:Arabidopsis thaliana


Alignment Length:240 Identity:58/240 - (24%)
Similarity:90/240 - (37%) Gaps:47/240 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 IRSLAME-KVASKLIFPCKHSHFGCRARLSYAEKTKHEEDCECRPYFCPYPDDKCSWQGPLRDVY 210
            |..|.:| :|...|.||.   |....:...|.....|.|:.:.:||.||:...||...|.::.:.
plant     5 INDLQVESRVHELLDFPV---HTNQISSAIYECPNDHIENPKKKPYNCPHSGAKCDVTGDIQRLL 66

  Fly   211 QHLMSSHENVITMEGNDII-----------------------------------FLATNVNLEGA 240
            .||.:.| ||...:|....                                   ||:.|     .
plant    67 LHLRNDH-NVEMSDGRSFSHRYVHHDPKHLHHATWMLTVSYITDYLALFLQLCEFLSFN-----P 125

  Fly   241 LDWTMVQSCHGRHFLLSLEKINLGEDCQQYFTACRMIGSMKDAAEFVYNISLEAYNRTLRWQSKP 305
            |:...:..|.||.|.|..|..:| .....|....:.:|..::|..|.|::.:....|.|.||..|
plant   126 LETMQLLDCCGRKFCLYFEAFHL-RKTPMYMAFMQFMGDEEEAMSFSYSLQVGGNGRKLTWQGVP 189

  Fly   306 RSIRENFSSFTNA-DFLVLNKHTVELFSEDGNLALNVVIRKVEER 349
            ||||::..:..:: |.|::.:.....||.|.|.....:..||..|
plant   190 RSIRDSHKTVRDSQDGLIITRKLALFFSTDNNTTDKELKLKVSGR 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sinahNP_648927.1 zf-C3HC4 106..140 CDD:278524
Sina 147..341 CDD:281181 55/230 (24%)
AT3G13672NP_001319542.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 106 1.000 Domainoid score I2183
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I1644
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780610at2759
OrthoFinder 1 1.000 - - FOG0001170
OrthoInspector 1 1.000 - - mtm1132
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X796
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.830

Return to query results.
Submit another query.