DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sinah and AT2G41980

DIOPT Version :9

Sequence 1:NP_648927.1 Gene:sinah / 39885 FlyBaseID:FBgn0259794 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_181729.1 Gene:AT2G41980 / 818798 AraportID:AT2G41980 Length:305 Species:Arabidopsis thaliana


Alignment Length:269 Identity:93/269 - (34%)
Similarity:138/269 - (51%) Gaps:18/269 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 TRSGA-------RDDFLMALLECPVCFGYIMPPIMQCPRGHLICSTCRSKL-TICPVCRVFMTNI 147
            |:||:       ..:.:..|||||||...:.|||.|||.||.:||:|:.:: ..||.||..:.||
plant    35 TKSGSGSIGKFHSSNGVYELLECPVCTNLMYPPIHQCPNGHTLCSSCKLRVQNTCPTCRYELGNI 99

  Fly   148 RSLAMEKVASKLIFPCKHSHFGCRARLSYAEKTKHEEDCECRPYFCPYPDDKCSWQGPLRDVYQH 212
            |.||:||||..|..||::.:.||:....|..|.|||:.|..|.|.|||...:||..|.:..:..|
plant   100 RCLALEKVAESLEVPCRYQNLGCQDIFPYYSKLKHEQHCRFRSYSCPYAGSECSVTGDIPTLVDH 164

  Fly   213 LMSSHENVITMEGNDII---FLATNVN-LEGALDWTMVQSCHGRHFLLSLEKINLGEDCQQYFTA 273
            |...|:  :.|......   ::.:|.: :|.|.....|.:|.||.|.|..|...||. ...|...
plant   165 LKDDHK--VDMHDGCTFNHRYVKSNPHEVENATWMLTVFNCFGRQFCLHFEAFQLGM-APVYMAF 226

  Fly   274 CRMIGSMKDAAEFVYNISLEAYNRTLRWQSKPRSIRENFSSFTNA-DFLVLNKHTVELF--SEDG 335
            .|.:|...:|.:|.|::.:.|::|.|.||..|||||::.....:: |.|::.::....|  |:..
plant   227 LRFMGDENEAKKFSYSLEVGAHSRKLTWQGIPRSIRDSHRKVRDSQDGLIIPRNLALYFSGSDKE 291

  Fly   336 NLALNVVIR 344
            .|.|.|..|
plant   292 ELKLRVTGR 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sinahNP_648927.1 zf-C3HC4 106..140 CDD:278524 17/34 (50%)
Sina 147..341 CDD:281181 65/200 (33%)
AT2G41980NP_181729.1 RING-HC_SIAHs 55..93 CDD:319485 19/37 (51%)
Sina 99..298 CDD:397316 65/201 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 106 1.000 Domainoid score I2183
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I1644
OMA 1 1.010 - - QHG60089
OrthoDB 1 1.010 - - D780610at2759
OrthoFinder 1 1.000 - - FOG0001170
OrthoInspector 1 1.000 - - mtm1132
orthoMCL 1 0.900 - - OOG6_104798
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X796
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.740

Return to query results.
Submit another query.