DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sinah and TRAF5

DIOPT Version :9

Sequence 1:NP_648927.1 Gene:sinah / 39885 FlyBaseID:FBgn0259794 Length:351 Species:Drosophila melanogaster
Sequence 2:XP_011508259.1 Gene:TRAF5 / 7188 HGNCID:12035 Length:631 Species:Homo sapiens


Alignment Length:385 Identity:80/385 - (20%)
Similarity:137/385 - (35%) Gaps:105/385 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 APALVVPPEETTHVVVVKRQSPDAAAAGELVPSRRKDSVAVQSGIVATG------PLDTTRSGAR 96
            |||   ||:.:..:...:|..|.||||    |:.|.......|..:|..      |....|..:.
Human    27 APA---PPQASPPLRRRRRPQPGAAAA----PADRPRGARAPSPTMAYSEEHKGMPCGFIRQNSG 84

  Fly    97 D----DF-----------LMALLECPVCFGYIMPPIMQCPRGHLICSTC---RSKLTICPVCRVF 143
            :    ||           |....:|..|...:..| .|...||..|..|   ..:|...|:|.|.
Human    85 NSISLDFEPSIEYQFVERLEERYKCAFCHSVLHNP-HQTGCGHRFCQHCILSLRELNTVPICPVD 148

  Fly   144 MTNIRSLAMEK-------VASKLIFPCKHSHFGCRARLSYAE----------KTKHEEDCECRPY 191
            ...|:|..:.|       |.:..:: |.::. ||.|::....          ...|.:.|..:|.
Human   149 KEVIKSQEVFKDNCCKREVLNLYVY-CSNAP-GCNAKVILGRYQVPLACCYLLQDHLQQCLFQPV 211

  Fly   192 FCPYPDDKCSWQGPLRDVYQHLMSS----------------------HENVITME-----GNDI- 228
            .|  .::||......:|:.:||.:|                      ||..:..|     .|:. 
Human   212 QC--SNEKCREPVLRKDLKEHLSASCQFRKEKCLYCKKDVVVINLQNHEENLCPEYPVFCPNNCA 274

  Fly   229 -IFLATNVNLEGALDWTMVQSCHGRHF--LLSLEKINLGEDCQQYFTACRMIGSMKDAAEFVY-- 288
             |.|.|.|:...|:.....|.|..:|:  .::.::.||    ||:..:     ::::....|.  
Human   275 KIILKTEVDEHLAVCPEAEQDCPFKHYGCAVTDKRRNL----QQHEHS-----ALREHMRLVLEK 330

  Fly   289 NISLEAYNRTL-----RWQSKPRSIRENFSSFTNADFLVLNKHTVELFSEDGNLALNVVI 343
            |:.||.....|     :.:||.:.:.|..... ..:|    |...:||.::|:...|:.:
Human   331 NVQLEEQISDLHKSLEQKESKIQQLAETIKKL-EKEF----KQFAQLFGKNGSFLPNIQV 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sinahNP_648927.1 zf-C3HC4 106..140 CDD:278524 10/36 (28%)
Sina 147..341 CDD:281181 47/248 (19%)
TRAF5XP_011508259.1 RING 109..145 CDD:214546 10/36 (28%)
zf-TRAF 202..257 CDD:280357 10/56 (18%)
zf-TRAF 257..315 CDD:280357 15/61 (25%)
MATH 478..624 CDD:295307
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.