DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sinah and SIAH2

DIOPT Version :9

Sequence 1:NP_648927.1 Gene:sinah / 39885 FlyBaseID:FBgn0259794 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_005058.3 Gene:SIAH2 / 6478 HGNCID:10858 Length:324 Species:Homo sapiens


Alignment Length:325 Identity:138/325 - (42%)
Similarity:193/325 - (59%) Gaps:15/325 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PTASGEMLTRRQSAPALVVPPEETTHVVVVKRQSPDAAAAGELVPSRRKDSVAV-QSGIVATGPL 88
            |:::|....:    |....||.:..|.     .||.|..|...:.:....|.|| .:..|.:||.
Human     4 PSSTGPSANK----PCSKQPPPQPQHT-----PSPAAPPAAATISAAGPGSSAVPAAAAVISGPG 59

  Fly    89 DTTRSG---ARDDFLMALLECPVCFGYIMPPIMQCPRGHLICSTCRSKLTICPVCRVFMT-NIRS 149
            ....:|   .:...|.:|.||||||.|::|||:||..|||:|:.||.||:.||.||..:| :||:
Human    60 GGGGAGPVSPQHHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTPSIRN 124

  Fly   150 LAMEKVASKLIFPCKHSHFGCRARLSYAEKTKHEEDCECRPYFCPYPDDKCSWQGPLRDVYQHLM 214
            ||||||||.::||||::..||...|.:.||.:||:.||.|||.||.|...|.|||.|..|..|||
Human   125 LAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLM 189

  Fly   215 SSHENVITMEGNDIIFLATNVNLEGALDWTMVQSCHGRHFLLSLEKINLGEDCQQYFTACRMIGS 279
            .:|:::.|::|.||:||||::||.||:||.|:|||.|.||:|.|||....|..||:|....:||:
Human   190 HAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGT 254

  Fly   280 MKDAAEFVYNISLEAYNRTLRWQSKPRSIRENF-SSFTNADFLVLNKHTVELFSEDGNLALNVVI 343
            .|.|..|.|.:.|....|.|.|::.||||.:.. ::..|:|.||.:.....||:::|||.:||.|
Human   255 RKQAENFAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTI 319

  Fly   344  343
            Human   320  319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sinahNP_648927.1 zf-C3HC4 106..140 CDD:278524 21/33 (64%)
Sina 147..341 CDD:281181 91/194 (47%)
SIAH2NP_005058.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42 10/46 (22%)
RING-HC_SIAH2 78..115 CDD:319666 22/36 (61%)
Sina 122..318 CDD:397316 92/195 (47%)
SBD. /evidence=ECO:0000250|UniProtKB:P61092 130..322 87/190 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60089
OrthoDB 1 1.010 - - D780610at2759
OrthoFinder 1 1.000 - - FOG0001170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45877
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X796
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.