DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sinah and SIAH1

DIOPT Version :9

Sequence 1:NP_648927.1 Gene:sinah / 39885 FlyBaseID:FBgn0259794 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001006611.1 Gene:SIAH1 / 6477 HGNCID:10857 Length:313 Species:Homo sapiens


Alignment Length:324 Identity:137/324 - (42%)
Similarity:193/324 - (59%) Gaps:26/324 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LTRRQSAPAL---------VVPPEETTHVVVVKRQSPDAAAAG--ELVPSRRKDSVAVQSGIVAT 85
            :|.:.:.|:|         .:|...|.....:.||:..|...|  :..||:|..::         
Human     1 MTGKATPPSLYSWRGVLFTCLPAARTRKRKEMSRQTATALPTGTSKCPPSQRVPAL--------- 56

  Fly    86 GPLDTTRSGARDDFLMALLECPVCFGYIMPPIMQCPRGHLICSTCRSKLTICPVCRVFMTNIRSL 150
                 |.:.|.::.|.:|.||||||.|::|||:||..|||:||.||.|||.||.||..:.:||:|
Human    57 -----TGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNL 116

  Fly   151 AMEKVASKLIFPCKHSHFGCRARLSYAEKTKHEEDCECRPYFCPYPDDKCSWQGPLRDVYQHLMS 215
            ||||||:.::||||::..||...|.:.||..|||.||.|||.||.|...|.|||.|..|..|||.
Human   117 AMEKVANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMH 181

  Fly   216 SHENVITMEGNDIIFLATNVNLEGALDWTMVQSCHGRHFLLSLEKINLGEDCQQYFTACRMIGSM 280
            .|:::.|::|.||:||||::||.||:||.|:|||.|.||:|.|||....:..||:|...::||:.
Human   182 QHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTR 246

  Fly   281 KDAAEFVYNISLEAYNRTLRWQSKPRSIRENF-SSFTNADFLVLNKHTVELFSEDGNLALNVVI 343
            |.|..|.|.:.|..:.|.|.|::.||||.|.. ::..|:|.||.:....:||:|:|||.:||.|
Human   247 KQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTI 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sinahNP_648927.1 zf-C3HC4 106..140 CDD:278524 23/33 (70%)
Sina 147..341 CDD:281181 92/194 (47%)
SIAH1NP_001006611.1 RING-HC_SIAH1 70..109 CDD:319665 26/38 (68%)
RING-HC finger (C3HC4-type) 72..106 CDD:319665 23/33 (70%)
Sina 113..309 CDD:367355 93/195 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60089
OrthoDB 1 1.010 - - D780610at2759
OrthoFinder 1 1.000 - - FOG0001170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104798
Panther 1 1.100 - - O PTHR45877
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X796
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.790

Return to query results.
Submit another query.