DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sinah and siah1

DIOPT Version :9

Sequence 1:NP_648927.1 Gene:sinah / 39885 FlyBaseID:FBgn0259794 Length:351 Species:Drosophila melanogaster
Sequence 2:XP_012816483.1 Gene:siah1 / 548553 XenbaseID:XB-GENE-1014415 Length:313 Species:Xenopus tropicalis


Alignment Length:286 Identity:132/286 - (46%)
Similarity:180/286 - (62%) Gaps:12/286 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 PSRRKDSVAVQSGIVATG----------PLDTTRSGARDDFLMALLECPVCFGYIMPPIMQCPRG 123
            |.|||:.....:..:.||          |..|..:.:.:| |.:|.||||||.|::|||:||..|
 Frog    26 PKRRKEMSRQTATAIPTGTSKCPPSQRVPALTGTTASNND-LASLFECPVCFDYVLPPILQCQSG 89

  Fly   124 HLICSTCRSKLTICPVCRVFMTNIRSLAMEKVASKLIFPCKHSHFGCRARLSYAEKTKHEEDCEC 188
            ||:||.||.|||.||.||..:.:||:|||||||:.::||||::..||...|.:.||..|||.||.
 Frog    90 HLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEVTLPHTEKADHEELCEF 154

  Fly   189 RPYFCPYPDDKCSWQGPLRDVYQHLMSSHENVITMEGNDIIFLATNVNLEGALDWTMVQSCHGRH 253
            |||.||.|...|.|||.|..|..|||..|:::.|::|.||:||||::||.||:||.|:|||.|.|
 Frog   155 RPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFH 219

  Fly   254 FLLSLEKINLGEDCQQYFTACRMIGSMKDAAEFVYNISLEAYNRTLRWQSKPRSIRENF-SSFTN 317
            |:|.|||....:..||:|...::||:.|.|..|.|.:.|..:.|.|.|::.||||.|.. ::..|
 Frog   220 FMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMN 284

  Fly   318 ADFLVLNKHTVELFSEDGNLALNVVI 343
            :|.||.:....:||:|:|||.:||.|
 Frog   285 SDCLVFDTSIAQLFAENGNLGINVTI 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sinahNP_648927.1 zf-C3HC4 106..140 CDD:278524 23/33 (70%)
Sina 147..341 CDD:281181 92/194 (47%)
siah1XP_012816483.1 RING-HC_SIAH1 70..109 CDD:319665 26/38 (68%)
RING-HC finger (C3HC4-type) 72..106 CDD:319665 23/33 (70%)
Sina 113..309 CDD:367355 93/195 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60089
OrthoDB 1 1.010 - - D780610at2759
OrthoFinder 1 1.000 - - FOG0001170
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45877
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X796
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.