DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sinah and CG6688

DIOPT Version :10

Sequence 1:NP_648927.1 Gene:sinah / 39885 FlyBaseID:FBgn0259794 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster


Alignment Length:97 Identity:34/97 - (35%)
Similarity:49/97 - (50%) Gaps:13/97 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 RKDSVAV-----------QSGIVATGPLDTT--RSGARDDFLMALLECPVCFGYIMPPIMQCPRG 123
            :||.|.:           .:..:...|:.|:  |.....:.::.|:|||||...|.||.|||..|
  Fly    97 QKDCVTILCWNSECDKDCDTNSICCAPMPTSLRRLSLVLESILRLVECPVCGVTISPPAMQCQNG 161

  Fly   124 HLICSTCRSKLTICPVCRVFMTNIRSLAMEKV 155
            ||:|..||.:...|||||.|.|..|:|..|::
  Fly   162 HLLCVDCRIRSERCPVCRDFYTPRRALLAEQI 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sinahNP_648927.1 RING_Ubox 102..151 CDD:473075 26/48 (54%)
Sina 147..341 CDD:460824 3/9 (33%)
CG6688NP_651110.1 PDZ_canonical 25..104 CDD:483948 3/6 (50%)
RING-HC_SIAHs 143..179 CDD:438233 20/35 (57%)

Return to query results.
Submit another query.