DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment sinah and CG34375

DIOPT Version :9

Sequence 1:	NP_648927.1	Gene:	sinah / 39885	FlyBaseID:	FBgn0259794	Length:	351	Species:	Drosophila melanogaster
Sequence 2:	NP_001163693.1	Gene:	CG34375 / 42715	FlyBaseID:	FBgn0085404	Length:	568	Species:	Drosophila melanogaster

Alignment Length:	64	Identity:	31/64 - (48%)
Similarity:	39/64 - (60%)	Gaps:	3/64 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly   103 LLECPVCFGYIMPPIMQCPRGHLICSTCRSKLTICPVCRVFM-TNIRSLAMEKVASKLI--FPC 163
            |||||||...|.||..||..||::|:.|||:...||||||.: ...|.|..:|:.:.|.  |||
  Fly   127 LLECPVCLEVIKPPGWQCCNGHVLCNNCRSRSVKCPVCRVPLGPRGRCLLSDKLFTLLAESFPC 190

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
sinah	NP_648927.1	zf-C3HC4	106..140	CDD:278524	17/33 (52%)
sinah	NP_648927.1	Sina	147..341	CDD:281181	7/19 (37%)
CG34375	NP_001163693.1	PDZ	13..86	CDD:238080
CG34375	NP_001163693.1	RING	129..168	CDD:238093	22/38 (58%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3002
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D780610at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	3	2.820