DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sinah and sina

DIOPT Version :9

Sequence 1:NP_648927.1 Gene:sinah / 39885 FlyBaseID:FBgn0259794 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001287089.1 Gene:sina / 39884 FlyBaseID:FBgn0003410 Length:314 Species:Drosophila melanogaster


Alignment Length:311 Identity:152/311 - (48%)
Similarity:195/311 - (62%) Gaps:23/311 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 KRQSPDAAAAGELV------------------PSRRKDSVAVQSGIVATGPLDTTRSGARDDFLM 101
            ||:.|.|||||...                  .|....|.:..|.:.:.|..|   :|...| |.
  Fly     8 KRREPTAAAAGAGATGVATNTSTSTGSSSAGNTSSANTSSSSSSSLSSAGGGD---AGMSAD-LT 68

  Fly   102 ALLECPVCFGYIMPPIMQCPRGHLICSTCRSKLTICPVCRVFMTNIRSLAMEKVASKLIFPCKHS 166
            :|.||||||.|::|||:||..|||:|.:||||||.||.||..:.|||:||||||||.:.||||||
  Fly    69 SLFECPVCFDYVLPPILQCSSGHLVCVSCRSKLTCCPTCRGPLANIRNLAMEKVASNVKFPCKHS 133

  Fly   167 HFGCRARLSYAEKTKHEEDCECRPYFCPYPDDKCSWQGPLRDVYQHLMSSHENVITMEGNDIIFL 231
            .:||.|.|.|.|||:|||.||||||.||.|...|.|||||..|.||||.||:::.|::|.||:||
  Fly   134 GYGCTASLVYTEKTEHEETCECRPYLCPCPGASCKWQGPLDLVMQHLMMSHKSITTLQGEDIVFL 198

  Fly   232 ATNVNLEGALDWTMVQSCHGRHFLLSLEKINLGEDCQQYFTACRMIGSMKDAAEFVYNISLEAYN 296
            ||::||.||:||.|:|||.|.||:|.|||....:..||:|...::|||.|:|..|||.:.|....
  Fly   199 ATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYDGHQQFFAIVQLIGSRKEAENFVYRLELNGNR 263

  Fly   297 RTLRWQSKPRSIRENF-SSFTNADFLVLNKHTVELFSEDGNLALNVVIRKV 346
            |.|.|::.||||.|.. |:..|:|.||.:....:||:::|||.:||.|..|
  Fly   264 RRLTWEAMPRSIHEGVASAIHNSDCLVFDTSIAQLFADNGNLGINVTISLV 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sinahNP_648927.1 zf-C3HC4 106..140 CDD:278524 23/33 (70%)
Sina 147..341 CDD:281181 104/194 (54%)
sinaNP_001287089.1 Sina 114..310 CDD:281181 105/195 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 106 1.000 Domainoid score I2183
eggNOG 1 0.900 - - E1_KOG3002
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I1644
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780610at2759
OrthoFinder 1 1.000 - - FOG0001170
OrthoInspector 1 1.000 - - mtm1132
orthoMCL 1 0.900 - - OOG6_104798
Panther 1 1.100 - - P PTHR45877
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X796
109.870

Return to query results.
Submit another query.