DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sinah and CG32486

DIOPT Version :9

Sequence 1:NP_648927.1 Gene:sinah / 39885 FlyBaseID:FBgn0259794 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_647765.1 Gene:CG32486 / 38367 FlyBaseID:FBgn0266918 Length:412 Species:Drosophila melanogaster


Alignment Length:334 Identity:84/334 - (25%)
Similarity:128/334 - (38%) Gaps:92/334 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SAPALVVPPEETTHVVVVKRQ--SPDAAAAGELVPSRRKDSVAVQSGIVATGPLDTTRSG---AR 96
            |:.|:..||..:...::...|  :..::|:.....|....|.:|..|.|...||||..||   |:
  Fly     6 SSSAVQQPPSSSNLPLLGDNQAVATTSSASSASSSSTSSSSSSVGGGNVVGVPLDTQGSGEPPAK 70

  Fly    97 DDFL------------MALLE---------------------CPVCFGYIMPPIMQCPRGHLICS 128
            ...|            .:||.                     |.||.......:.||..|||:|:
  Fly    71 KQLLDGGGGGATSSSGSSLLSSAAAASGMHEKLAHRISNALCCAVCLDLPKTAMYQCQMGHLMCA 135

  Fly   129 TC----------RSKLTICPVCRVFM---TNIRSLAMEKVASKLIFPCKHSHFGCRARLSYAEKT 180
            .|          |.::..||.|||.:   |..|:||:||.||:|...|:.    |.....|....
  Fly   136 ACFTHLLADGRLRDQIATCPNCRVEISKSTASRNLAVEKAASELPSECQF----CNKEFPYKSLE 196

  Fly   181 KHEE-DCECRPYFCPYPDDKCSWQGPLRDVYQH-------LMSSHENVITMEGNDIIFLATNVNL 237
            :||: :|:.||..|.|....|.|:||..:..:|       ..|.:|.:..:|.:|     ..:..
  Fly   197 RHEQHECQERPTKCKYHRIGCQWRGPYHETNEHERNCLHPQKSGYEVMAALEAHD-----DRIKE 256

  Fly   238 EGALDWTMVQSCHGRHFLLSLEKINLGEDCQQYFTACRMIGSMKDAAEFVYNISLE-----AYNR 297
            |..:..|::.       |||.|||        .|...:|.....|  |:|:.:..|     |:|:
  Fly   257 EKKMFNTLID-------LLSYEKI--------IFNDLQMKPYRTD--EYVHKLFYETARFSAFNQ 304

  Fly   298 TLRWQSKPR 306
              :|..|.|
  Fly   305 --QWVVKAR 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sinahNP_648927.1 zf-C3HC4 106..140 CDD:278524 13/43 (30%)
Sina 147..341 CDD:281181 46/173 (27%)
CG32486NP_647765.1 zf-C3HC4_3 109..164 CDD:290631 16/54 (30%)
Sina 168..>232 CDD:302762 23/67 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.