DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sinah and siah2l

DIOPT Version :9

Sequence 1:NP_648927.1 Gene:sinah / 39885 FlyBaseID:FBgn0259794 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_956721.2 Gene:siah2l / 378728 ZFINID:ZDB-GENE-030922-1 Length:330 Species:Danio rerio


Alignment Length:295 Identity:133/295 - (45%)
Similarity:179/295 - (60%) Gaps:9/295 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 SPDAAAAGELVPSRRKDSVAVQSGIVATG-------PLDTTRSGARDDFLMALLECPVCFGYIMP 115
            |..||||.....:....:..|...:..:|       .|.......:...|.||.||||||.|::|
Zfish    33 SAAAAAAAAAAAAAAAAAAGVSGSVAGSGTVPAAAVALPVAALPGQSPELTALFECPVCFDYVLP 97

  Fly   116 PIMQCPRGHLICSTCRSKLTICPVCRVFMT-NIRSLAMEKVASKLIFPCKHSHFGCRARLSYAEK 179
            ||:||..|||:|:.||.||:.||.||..:| :||:||||||||.|.||||:|..||...|.::||
Zfish    98 PILQCQAGHLVCNQCRQKLSCCPTCRGPLTPSIRNLAMEKVASTLPFPCKYSSAGCLLSLHHSEK 162

  Fly   180 TKHEEDCECRPYFCPYPDDKCSWQGPLRDVYQHLMSSHENVITMEGNDIIFLATNVNLEGALDWT 244
            .:|||.||.|||.||.|...|.|||.|.:|..|||.:|:::.|::|.||:||||::||.||:||.
Zfish   163 PEHEEVCEFRPYTCPCPGASCKWQGSLEEVMPHLMHAHKSITTLQGEDIVFLATDINLPGAVDWV 227

  Fly   245 MVQSCHGRHFLLSLEKINLGEDCQQYFTACRMIGSMKDAAEFVYNISLEAYNRTLRWQSKPRSIR 309
            |:|||.|.||:|.|||....|..||:|....:||:.|.|..|.|.:.|....|.|.|::.||||.
Zfish   228 MMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIH 292

  Fly   310 ENF-SSFTNADFLVLNKHTVELFSEDGNLALNVVI 343
            :.. ::..|:|.||.:.....||:::|||.:||.|
Zfish   293 DGVAAAIMNSDCLVFDTSIAHLFADNGNLGINVTI 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sinahNP_648927.1 zf-C3HC4 106..140 CDD:278524 21/33 (64%)
Sina 147..341 CDD:281181 94/194 (48%)
siah2lNP_956721.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
Sina 130..326 CDD:281181 95/195 (49%)
SBD 138..330 90/190 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60089
OrthoDB 1 1.010 - - D780610at2759
OrthoFinder 1 1.000 - - FOG0001170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45877
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X796
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.890

Return to query results.
Submit another query.