DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sinah and SIAH3

DIOPT Version :9

Sequence 1:NP_648927.1 Gene:sinah / 39885 FlyBaseID:FBgn0259794 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_942146.2 Gene:SIAH3 / 283514 HGNCID:30553 Length:269 Species:Homo sapiens


Alignment Length:265 Identity:78/265 - (29%)
Similarity:117/265 - (44%) Gaps:36/265 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 CFGYIMPPI-----------MQCPRGHLICSTCRSKLTICPVCRV-FMTNIRSLAMEKVASKLIF 161
            |||.::..|           :....|.|:|       .:.|...: ::::.|::...........
Human     7 CFGAVLDLIHLRFQHYKAKRVFSAAGQLVC-------VVNPTHNLKYVSSRRAVTQSAPEQGSFH 64

  Fly   162 PCKHSHFGCRAR-------------LSYAEKTKHEEDCECRPYFCPYPDDKCSWQGPLRDVYQHL 213
            |...||..|..|             |.:.|...|..  ...|..|..|...|.|:|.|..|..||
Human    65 PHHLSHHHCHHRHHHHLRHHAHPHHLHHQEAGLHAN--PVTPCLCMCPLFSCQWEGRLEVVVPHL 127

  Fly   214 MSSHENVITMEGNDIIFLATNVNLEGALDWTMVQSCHGRHFLLSLEKINLGEDCQQYFTACRMIG 278
            ...| .|..::|.:|:||||:::|....||.::.||.|.||||.|.|....|...|:|....:||
Human   128 RQIH-RVDILQGAEIVFLATDMHLPAPADWIIMHSCLGHHFLLVLRKQERHEGHPQFFATMMLIG 191

  Fly   279 SMKDAAEFVYNISLEAYNRTLRWQSKPRSIRENFSS-FTNADFLVLNKHTVELFSEDGNLALNVV 342
            :...|..|.|.:.|...:|.|:|::.|||:.|...| .|:.|.||||....:|||::|:||:.:.
Human   192 TPTQADCFTYRLELNRNHRRLKWEATPRSVLECVDSVITDGDCLVLNTSLAQLFSDNGSLAIGIA 256

  Fly   343 IRKVE 347
            |...|
Human   257 ITATE 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sinahNP_648927.1 zf-C3HC4 106..140 CDD:278524 8/41 (20%)
Sina 147..341 CDD:281181 68/207 (33%)
SIAH3NP_942146.2 Sina 133..259 CDD:239753 49/125 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780610at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45877
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.