DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sinah and ADAM2

DIOPT Version :9

Sequence 1:NP_648927.1 Gene:sinah / 39885 FlyBaseID:FBgn0259794 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001455.3 Gene:ADAM2 / 2515 HGNCID:198 Length:735 Species:Homo sapiens


Alignment Length:364 Identity:66/364 - (18%)
Similarity:121/364 - (33%) Gaps:147/364 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SAPALVVPPEETTHVVVVKRQSPDAAAAGELVPSRRKDSVAVQ--------------SGIVATGP 87
            |.|..:..||:...::   ::..::.|:.::|...:..:|.:.              ||.....|
Human    22 SLPVQITVPEKIRSII---KEGIESQASYKIVIEGKPYTVNLMQKNFLPHNFRVYSYSGTGIMKP 83

  Fly    88 LDTTRSGARDDF-----LMALLECPVCFGYIMPPIMQCPRGHLICSTCRSKLTICPVCRVFMTNI 147
            ||       .||     ....:|     ||        |:..::.|||              |.:
Human    84 LD-------QDFQNFCHYQGYIE-----GY--------PKSVVMVSTC--------------TGL 114

  Fly   148 RS-LAMEKVA------------SKLIFPCKHSHFGCRARLS-YAEKTKHEED-------CECRPY 191
            |. |..|.|:            ..:|:..||.    :|.:| |.||.....|       .|.:..
Human   115 RGVLQFENVSYGIEPLESSVGFEHVIYQVKHK----KADVSLYNEKDIESRDLSFKLQSVEPQQD 175

  Fly   192 FCPYPDDKCSWQGPLRDVYQHLMSS----HENVITMEG-NDIIFLATNVNLEGALDWTMVQSCHG 251
            |..|.:.....:   :.:|.|:.|.    .:.|..:.| .:.||::.|:.:              
Human   176 FAKYIEMHVIVE---KQLYNHMGSDTTVVAQKVFQLIGLTNAIFVSFNITI-------------- 223

  Fly   252 RHFLLSLEKINLGEDCQQYFTACRMIGSMKDAAEFVYNISLEAYNRTLRWQS-----KPRSI--- 308
               :||..::.:.|:         .|.:..:|.|.::..        |||::     :|..:   
Human   224 ---ILSSLELWIDEN---------KIATTGEANELLHTF--------LRWKTSYLVLRPHDVAFL 268

  Fly   309 ---RENFSSFTNADF------------LVLNKHTVELFS 332
               ||. |::..|.|            :||:..|:.|.|
Human   269 LVYREK-SNYVGATFQGKMCDANYAGGVVLHPRTISLES 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sinahNP_648927.1 zf-C3HC4 106..140 CDD:278524 6/33 (18%)
Sina 147..341 CDD:281181 44/235 (19%)
ADAM2NP_001455.3 Pep_M12B_propep 42..140 CDD:279848 22/131 (17%)
Reprolysin 178..375 CDD:279729 29/167 (17%)
ZnMc_adamalysin_II_like 178..373 CDD:239797 29/167 (17%)
DISIN 393..470 CDD:214490
ACR 472..609 CDD:214743
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S11711
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.