DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sinah and Trim50

DIOPT Version :9

Sequence 1:NP_648927.1 Gene:sinah / 39885 FlyBaseID:FBgn0259794 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001333674.1 Gene:Trim50 / 215061 MGIID:2664992 Length:484 Species:Mus musculus


Alignment Length:256 Identity:53/256 - (20%)
Similarity:89/256 - (34%) Gaps:66/256 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 LECPVCFGYIMPPIM-QCPRGHLICSTCRSKLT-------ICPVCRVFM---TNIRSLAMEKVAS 157
            |:||:|......|:| ||  ||..|..|...|:       .|||||..:   ::..::::.:|..
Mouse    14 LQCPICLEVFKEPLMLQC--GHSYCKDCLDNLSQHLDSELCCPVCRQSVDCSSSPPNVSLARVID 76

  Fly   158 KLIFP-------CKHSHFGCRARLS-YAEKTKHEEDCECRPYFCPYPDDKCSWQG--------PL 206
            .|..|       |.|.    |..|| :.||.:.        :.|    ..|...|        |:
Mouse    77 ALRLPGDIEPTVCVHH----RNPLSLFCEKDQE--------FIC----GLCGLLGSHQHHRVTPV 125

  Fly   207 RDVY-----------QHLMSSHENVITMEGNDIIFLATNVNLEGALDWTMVQSCHGRHFLLSLEK 260
            ..||           ..|...|.||....|..:......:|......|.:.:.....|.|:..||
Mouse   126 STVYSRMKEELAGRISELKEEHRNVEEHIGKLVNNRTRIINESDVFSWVIRREFQELHHLVDEEK 190

  Fly   261 INLGEDCQQYFTACRMIGSMKDAAEFVYNISLEAYNRTLRWQSKPRSIRENFSSFTNADFL 321
            ....|..:.:...  ::.|:        ::.||....|....::...:.|.|.:.::.:|:
Mouse   191 ARCLEGLEGHTRG--LVASL--------DMQLEQAQGTQERLAQAEQVLEQFGNESHHEFI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sinahNP_648927.1 zf-C3HC4 106..140 CDD:278524 14/41 (34%)
Sina 147..341 CDD:281181 35/202 (17%)
Trim50NP_001333674.1 RING-HC_TRIM50_like_C-IV 14..58 CDD:319519 17/45 (38%)
RING-HC finger (C3HC4-type) 16..56 CDD:319519 14/41 (34%)
Bbox_SF 88..125 CDD:381767 10/52 (19%)
End3 <131..231 CDD:372297 16/109 (15%)
SPRY_PRY_TRIM50 283..471 CDD:293977
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.