DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sinah and Siah2

DIOPT Version :9

Sequence 1:NP_648927.1 Gene:sinah / 39885 FlyBaseID:FBgn0259794 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_033200.2 Gene:Siah2 / 20439 MGIID:108062 Length:325 Species:Mus musculus


Alignment Length:340 Identity:143/340 - (42%)
Similarity:196/340 - (57%) Gaps:23/340 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SRPQLSWPERVSPQRTIDTPTASGEMLTRRQSAPALVVPPEETTHVVVVKRQSPDAAAAGELVPS 70
            |||..:.|....|......|       .:...||:...||...|    :....|.::|    ||:
Mouse     2 SRPSSTGPSANKPCSKQPPP-------PQTPHAPSPAAPPAAAT----ISAAGPGSSA----VPA 51

  Fly    71 RRKDSVAVQSGIVATGPLDTTRSGARDDFLMALLECPVCFGYIMPPIMQCPRGHLICSTCRSKLT 135
                :.||.||..|.|..|.......:  |.:|.||||||.|::|||:||..|||:|:.||.||:
Mouse    52 ----AAAVISGPGAGGGADPVSPQHHE--LTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLS 110

  Fly   136 ICPVCRVFMT-NIRSLAMEKVASKLIFPCKHSHFGCRARLSYAEKTKHEEDCECRPYFCPYPDDK 199
            .||.||..:| :||:||||||||.::||||::..||...|.:.||.:||:.||.|||.||.|...
Mouse   111 CCPTCRGALTPSIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGAS 175

  Fly   200 CSWQGPLRDVYQHLMSSHENVITMEGNDIIFLATNVNLEGALDWTMVQSCHGRHFLLSLEKINLG 264
            |.|||.|..|..|||.:|:::.|::|.||:||||::||.||:||.|:|||.|.||:|.|||....
Mouse   176 CKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKY 240

  Fly   265 EDCQQYFTACRMIGSMKDAAEFVYNISLEAYNRTLRWQSKPRSIRENF-SSFTNADFLVLNKHTV 328
            |..||:|....:||:.|.|..|.|.:.|....|.|.|::.||||.:.. ::..|:|.||.:....
Mouse   241 EGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFDTAIA 305

  Fly   329 ELFSEDGNLALNVVI 343
            .||:::|||.:||.|
Mouse   306 HLFADNGNLGINVTI 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sinahNP_648927.1 zf-C3HC4 106..140 CDD:278524 21/33 (64%)
Sina 147..341 CDD:281181 91/194 (47%)
Siah2NP_033200.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 11/51 (22%)
Sina 123..319 CDD:281181 92/195 (47%)
SBD. /evidence=ECO:0000250|UniProtKB:P61092 131..323 87/190 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60089
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45877
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X796
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.