DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sinah and mes-4

DIOPT Version :9

Sequence 1:NP_648927.1 Gene:sinah / 39885 FlyBaseID:FBgn0259794 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_506333.1 Gene:mes-4 / 179824 WormBaseID:WBGene00003222 Length:898 Species:Caenorhabditis elegans


Alignment Length:193 Identity:47/193 - (24%)
Similarity:73/193 - (37%) Gaps:48/193 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RSKLTICPVCRVFM-TNIRS---LAMEKVA-SKLIF---PCKHSHFGCRARLSYAEKTKHEEDCE 187
            ::.:|:.|...|.| ::|::   :..||.: ||.|.   .|:..|.|||...:...|...::.||
 Worm   286 KNAVTVVPKADVTMKSHIKACCVIGCEKSSNSKTIMCKTCCRSFHSGCREVETLNGKPIPDDQCE 350

  Fly   188 CRPYFCPYPD---------DKCSWQGPLRDVYQHLMSSHENVITMEGNDIIFLATNVNLEGALDW 243
            ......|.|.         |...|.....|.|::          ..||     ..|:|.| .|.:
 Worm   351 SCVCGDPIPQNTLILAKWTDNSFWLALTLDWYKY----------PTGN-----RGNINFE-RLGY 399

  Fly   244 TMVQSCHGRHFLLSLEKINLGEDCQQYFTACRMIGSMKDAAEFVYNISLEAYNRTLR--WQSK 304
            |:||      :|:..|.   .::.|...:    |..:.|.|....|....|.|.|||  |:.|
 Worm   400 TVVQ------WLIPQEN---DKEKQPLMS----IVPVSDIARLTKNYFSLAKNSTLRNLWEEK 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sinahNP_648927.1 zf-C3HC4 106..140 CDD:278524 2/8 (25%)
Sina 147..341 CDD:281181 43/176 (24%)
mes-4NP_506333.1 PHD_SF 207..269 CDD:304600
SET 537..671 CDD:214614
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S11711
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.