DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sinah and TRIM50

DIOPT Version :9

Sequence 1:NP_648927.1 Gene:sinah / 39885 FlyBaseID:FBgn0259794 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001268380.1 Gene:TRIM50 / 135892 HGNCID:19017 Length:487 Species:Homo sapiens


Alignment Length:195 Identity:44/195 - (22%)
Similarity:72/195 - (36%) Gaps:56/195 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 LECPVCFGYIMPPIM-QCPRGHLICSTCRSKLTI-------CPVCRVFM---TNIRSLAMEKVAS 157
            |:||:|......|:| ||  ||..|..|...|:.       |||||..:   :::.::::.:|..
Human    14 LQCPICLEVFKEPLMLQC--GHSYCKGCLVSLSCHLDAELRCPVCRQAVDGSSSLPNVSLARVIE 76

  Fly   158 KLIFP-------CKHSHFGCRARLS-YAEKTKHEEDCECRPYFCPYPDDKCSWQG--------PL 206
            .|..|       |.|.    |..|| :.||   :::..|         ..|...|        |:
Human    77 ALRLPGDPEPKVCVHH----RNPLSLFCEK---DQELIC---------GLCGLLGSHQHHPVTPV 125

  Fly   207 RDVYQHLMSSHENVIT------MEGNDIIFLATN-----VNLEGALDWTMVQSCHGRHFLLSLEK 260
            ..||..:......:|:      .:.:::|....|     ||......|.:.:.....|.|:..||
Human   126 STVYSRMKEELAALISELKQEQKKVDELIAKLVNNRTRIVNESDVFSWVIRREFQELHHLVDEEK 190

  Fly   261  260
            Human   191  190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sinahNP_648927.1 zf-C3HC4 106..140 CDD:278524 14/41 (34%)
Sina 147..341 CDD:281181 26/141 (18%)
TRIM50NP_001268380.1 RING-HC_TRIM50_like_C-IV 14..58 CDD:319519 17/45 (38%)
RING-HC finger (C3HC4-type) 16..56 CDD:319519 14/41 (34%)
BBOX 90..125 CDD:237988 9/50 (18%)
SPRY_PRY_TRIM50 283..469 CDD:293977
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 468..487
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.