DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sinah and siah3

DIOPT Version :9

Sequence 1:NP_648927.1 Gene:sinah / 39885 FlyBaseID:FBgn0259794 Length:351 Species:Drosophila melanogaster
Sequence 2:XP_002941011.1 Gene:siah3 / 100497552 XenbaseID:XB-GENE-6035790 Length:241 Species:Xenopus tropicalis


Alignment Length:247 Identity:73/247 - (29%)
Similarity:115/247 - (46%) Gaps:36/247 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 CFGYIMPPI------MQCPR-----GHLICSTCRSKLTICPVCRVFMTNIRSLAMEKVASKLIFP 162
            |||.::..:      .|..|     |.|:|       .:.|...:...:.||...|:.:|:    
 Frog     7 CFGAVLDLLHLRFQHYQAKRVFSSAGQLVC-------VVNPTQNLQNGSNRSAVPEEDSSE---- 60

  Fly   163 CKHSHFGCRARLSYAEKTKHEEDCECRPYFCPYPDDKCSWQGPLRDVYQHLMSSHENVITMEGND 227
             :...:.||..::..:.|    .|.|..|       .|.|:|.|..:..||..|| .:..:.|.:
 Frog    61 -RKEQYLCRQSVNDPQLT----SCTCPLY-------SCKWEGHLEVIVSHLTQSH-TINILHGTE 112

  Fly   228 IIFLATNVNLEGALDWTMVQSCHGRHFLLSLEKINLGEDCQQYFTACRMIGSMKDAAEFVYNISL 292
            |:||||:::|...:||.:..||.|.||||.|.|....:...|:|....:||:...|..|.|.:.|
 Frog   113 IVFLATDMHLPAPVDWIITHSCLGHHFLLVLRKQEKYQGYPQFFATMMLIGTSAQAQNFNYKLEL 177

  Fly   293 EAYNRTLRWQSKPRSIRENFSS-FTNADFLVLNKHTVELFSEDGNLALNVVI 343
            ....|.|.|:|.|||:.:...| .|:.|.|:||....:|||::|:||:.:.|
 Frog   178 NRNRRKLTWESTPRSVFDCVDSVITDGDCLILNASVAQLFSDNGSLAIGIAI 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sinahNP_648927.1 zf-C3HC4 106..140 CDD:278524 9/41 (22%)
Sina 147..341 CDD:281181 63/194 (32%)
siah3XP_002941011.1 Sina 105..229 CDD:239753 45/123 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780610at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.