DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sinah and siah2

DIOPT Version :9

Sequence 1:NP_648927.1 Gene:sinah / 39885 FlyBaseID:FBgn0259794 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001095281.1 Gene:siah2 / 100124319 XenbaseID:XB-GENE-1004950 Length:318 Species:Xenopus tropicalis


Alignment Length:324 Identity:133/324 - (41%)
Similarity:189/324 - (58%) Gaps:19/324 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PTASGEMLTR---RQSAPALVVPPEETTHVVVVKRQSPDAAAAGELVPSRRKDSVAVQSGIVATG 86
            |:::|...::   :|..|    ||....|...:...:..:...|...|.....:.|     ..||
 Frog     4 PSSAGPCASKPCGKQKQP----PPPPPPHAASLSLPATISGGPGSSAPPPPAAAAA-----AITG 59

  Fly    87 PLDTTRSGARDDFLMALLECPVCFGYIMPPIMQCPRGHLICSTCRSKLTICPVCRVFMT-NIRSL 150
            ||     ..:...|.:|.||||||.|::|||:||..|||:|:.||.||:.||.||..:| :||:|
 Frog    60 PL-----SQQHQELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRASLTPSIRNL 119

  Fly   151 AMEKVASKLIFPCKHSHFGCRARLSYAEKTKHEEDCECRPYFCPYPDDKCSWQGPLRDVYQHLMS 215
            |||||||.::||||::..||...|.:.||.:||:.||.|||.||.|...|.|||.|.:|.|||..
 Frog   120 AMEKVASAVLFPCKYASTGCSLSLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLENVMQHLTH 184

  Fly   216 SHENVITMEGNDIIFLATNVNLEGALDWTMVQSCHGRHFLLSLEKINLGEDCQQYFTACRMIGSM 280
            ||:::.|::|.||:||||::||.||:||.|:|.|...||:|.|||....|..||:|....:||:.
 Frog   185 SHKSITTLQGEDIVFLATDINLPGAVDWVMMQYCFNHHFMLVLEKQEKYEGHQQFFAIVLLIGTR 249

  Fly   281 KDAAEFVYNISLEAYNRTLRWQSKPRSIRENF-SSFTNADFLVLNKHTVELFSEDGNLALNVVI 343
            |.|..:.|.:.|....|.|.|::.||||.:.. ::..|:|.||.:.....||:::|||.:||.|
 Frog   250 KQAENYAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTI 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sinahNP_648927.1 zf-C3HC4 106..140 CDD:278524 21/33 (64%)
Sina 147..341 CDD:281181 89/194 (46%)
siah2NP_001095281.1 RING_Ubox 72..109 CDD:418438 22/36 (61%)
Sina 116..312 CDD:397316 90/195 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780610at2759
OrthoFinder 1 1.000 - - FOG0001170
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X796
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.