DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sina and AT5G53360

DIOPT Version :10

Sequence 1:NP_476725.1 Gene:sina / 39884 FlyBaseID:FBgn0003410 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_200148.2 Gene:AT5G53360 / 835417 AraportID:AT5G53360 Length:233 Species:Arabidopsis thaliana


Alignment Length:213 Identity:61/213 - (28%)
Similarity:97/213 - (45%) Gaps:35/213 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 LAMEKVASNVKFPCKHSGYGCTASLVYTEKTEHEETCECRPYLCPCPGASCKWQGPLDLVMQHLM 181
            :|:||||.:::.|||:...||.....|..|.:||..|..|||.||..|:.|...|.:..::.||.
plant    15 IALEKVAESLELPCKYYNLGCLGIFPYYSKLKHESQCNFRPYSCPYAGSECAAVGDITFLVAHLR 79

  Fly   182 MSHKSITTLQGEDIVFLATDINL--------PGAVD---WVM-MQSCFGHHFMLVLEKQEKYDGH 234
            ..||          |.:.|....        |..|:   |:: :..|||.:|.|      .::..
plant    80 DDHK----------VDMHTGCTFNHRYVKSNPREVENATWMLTVFQCFGQYFCL------HFEAF 128

  Fly   235 Q-----QFFAIVQLIGSRKEAENFVYRLELNGNRRRLTWEAMPRSIHEGVASAIHNSDCLVFDTS 294
            |     .:.|.::.:|...:|.|:.|.||:.|:.|:.|||..|||:.:.......:.|.|:...:
plant   129 QLGMAPVYMAFLRFMGDEDDARNYTYSLEVGGSGRKQTWEGTPRSVRDSHRKVRDSHDGLIIQRN 193

  Fly   295 IAQLFA--DNGNLGINVT 310
            :|..|:  |...|.:.||
plant   194 MALFFSGGDKKELKLRVT 211

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity