DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sina and AT5G53360

DIOPT Version :9

Sequence 1:NP_001287089.1 Gene:sina / 39884 FlyBaseID:FBgn0003410 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001330825.1 Gene:AT5G53360 / 835417 AraportID:AT5G53360 Length:233 Species:Arabidopsis thaliana


Alignment Length:213 Identity:61/213 - (28%)
Similarity:97/213 - (45%) Gaps:35/213 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 LAMEKVASNVKFPCKHSGYGCTASLVYTEKTEHEETCECRPYLCPCPGASCKWQGPLDLVMQHLM 181
            :|:||||.:::.|||:...||.....|..|.:||..|..|||.||..|:.|...|.:..::.||.
plant    15 IALEKVAESLELPCKYYNLGCLGIFPYYSKLKHESQCNFRPYSCPYAGSECAAVGDITFLVAHLR 79

  Fly   182 MSHKSITTLQGEDIVFLATDINL--------PGAVD---WVM-MQSCFGHHFMLVLEKQEKYDGH 234
            ..||          |.:.|....        |..|:   |:: :..|||.:|.|      .::..
plant    80 DDHK----------VDMHTGCTFNHRYVKSNPREVENATWMLTVFQCFGQYFCL------HFEAF 128

  Fly   235 Q-----QFFAIVQLIGSRKEAENFVYRLELNGNRRRLTWEAMPRSIHEGVASAIHNSDCLVFDTS 294
            |     .:.|.::.:|...:|.|:.|.||:.|:.|:.|||..|||:.:.......:.|.|:...:
plant   129 QLGMAPVYMAFLRFMGDEDDARNYTYSLEVGGSGRKQTWEGTPRSVRDSHRKVRDSHDGLIIQRN 193

  Fly   295 IAQLFA--DNGNLGINVT 310
            :|..|:  |...|.:.||
plant   194 MALFFSGGDKKELKLRVT 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sinaNP_001287089.1 Sina 114..310 CDD:281181 59/211 (28%)
AT5G53360NP_001330825.1 Sina 15..211 CDD:397316 59/211 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 106 1.000 Domainoid score I2183
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I1644
OMA 1 1.010 - - QHG60089
OrthoDB 1 1.010 - - D780610at2759
OrthoFinder 1 1.000 - - FOG0001170
OrthoInspector 1 1.000 - - mtm1132
orthoMCL 1 0.900 - - OOG6_104798
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X796
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.740

Return to query results.
Submit another query.