DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sina and AT3G13672

DIOPT Version :9

Sequence 1:NP_001287089.1 Gene:sina / 39884 FlyBaseID:FBgn0003410 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001319542.1 Gene:AT3G13672 / 820573 AraportID:AT3G13672 Length:243 Species:Arabidopsis thaliana


Alignment Length:227 Identity:56/227 - (24%)
Similarity:93/227 - (40%) Gaps:46/227 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 IRNLAME-KVASNVKFPCKHSGYGCTASLVYTEKTEHEETCECRPYLCPCPGASCKWQGPLDLVM 177
            |.:|.:| :|...:.||. |:..  .:|.:|....:|.|..:.:||.||..||.|...|.:..::
plant     5 INDLQVESRVHELLDFPV-HTNQ--ISSAIYECPNDHIENPKKKPYNCPHSGAKCDVTGDIQRLL 66

  Fly   178 QHLMMSHKSITTLQGEDIV-------------------------FLATDINLP-----GAVDWVM 212
            .||...| ::....|....                         :||..:.|.     ..::.:.
plant    67 LHLRNDH-NVEMSDGRSFSHRYVHHDPKHLHHATWMLTVSYITDYLALFLQLCEFLSFNPLETMQ 130

  Fly   213 MQSCFGHHFMLVLE-----KQEKYDGHQQFFAIVQLIGSRKEAENFVYRLELNGNRRRLTWEAMP 272
            :..|.|..|.|..|     |...|      .|.:|.:|..:||.:|.|.|::.||.|:|||:.:|
plant   131 LLDCCGRKFCLYFEAFHLRKTPMY------MAFMQFMGDEEEAMSFSYSLQVGGNGRKLTWQGVP 189

  Fly   273 RSIHEGVASAIHNSDCLVFDTSIAQLFADNGN 304
            |||.:...:...:.|.|:....:|..|:.:.|
plant   190 RSIRDSHKTVRDSQDGLIITRKLALFFSTDNN 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sinaNP_001287089.1 Sina 114..310 CDD:281181 56/227 (25%)
AT3G13672NP_001319542.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 106 1.000 Domainoid score I2183
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I1644
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780610at2759
OrthoFinder 1 1.000 - - FOG0001170
OrthoInspector 1 1.000 - - mtm1132
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X796
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.