DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sina and Cyhr1

DIOPT Version :9

Sequence 1:NP_001287089.1 Gene:sina / 39884 FlyBaseID:FBgn0003410 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001263250.1 Gene:Cyhr1 / 54151 MGIID:1859320 Length:412 Species:Mus musculus


Alignment Length:303 Identity:68/303 - (22%)
Similarity:118/303 - (38%) Gaps:48/303 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PTAAAAG-AGATGV--------ATNTSTSTGSSSAGNTSSANTSSSSSSSLSSAGGGDAGMSADL 67
            |.|||.| |...|:        |.....:.|...|........:.::.::.::...|...:...|
Mouse    36 PAAAALGEAAGPGIPDEAALAGARQLQEAAGDPDAPPKKRLRAAEAAEAAAAAVAAGSGKLEERL 100

  Fly    68 TSLFECPVCFDYVLPPILQCSSGHLVCVSC----------RSKLTCCPTCRGPLAN---IRNLAM 119
            .|:..|.||.|.....:.||::|||:|..|          :.:...||.||..::.   .||||:
Mouse   101 YSVLCCTVCLDLPKASVYQCTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAV 165

  Fly   120 EKVASNVKFPCKHSGYGCTASLVYTEKTEHE-ETCECRPYLCPCPGASCKWQGPL-DLVMQHLMM 182
            ||..|.:...|   |: |......:....|: |.|:.|...|......|.|.||. :|.:.....
Mouse   166 EKAVSELPSEC---GF-CLRQFPRSLLERHQKEECQDRVTQCKYKRIGCPWHGPFHELTVHEAAC 226

  Fly   183 SHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYDGHQQFFAIVQLIGSR 247
            :|.:.|   |.:::.:..:::.....:..:..|.|.   :|..||    .|:..:.....|..:.
Mouse   227 AHPTKT---GNELMEILDEMDQSHRKEMQLYNSIFS---LLSFEK----IGYTVWVFGPYLWSTE 281

  Fly   248 KEAENF----VYRLELNGNR-----RRLTWEAMPRSIHEGVAS 281
            :|..:.    |||..|....     ::|..:.:|... ||::|
Mouse   282 QEEHSIKSDPVYRCSLKATEPPEAGKKLFGDRVPEQA-EGLSS 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sinaNP_001287089.1 Sina 114..310 CDD:281181 40/179 (22%)
Cyhr1NP_001263250.1 Sina 161..>222 CDD:302762 20/64 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.