powered by:
Protein Alignment sina and CG6688
DIOPT Version :9
Sequence 1: | NP_001287089.1 |
Gene: | sina / 39884 |
FlyBaseID: | FBgn0003410 |
Length: | 314 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_651110.1 |
Gene: | CG6688 / 42716 |
FlyBaseID: | FBgn0039038 |
Length: | 424 |
Species: | Drosophila melanogaster |
Alignment Length: | 53 |
Identity: | 24/53 - (45%) |
Similarity: | 31/53 - (58%) |
Gaps: | 0/53 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 70 LFECPVCFDYVLPPILQCSSGHLVCVSCRSKLTCCPTCRGPLANIRNLAMEKV 122
|.|||||...:.||.:||.:|||:||.||.:...||.||......|.|..|::
Fly 141 LVECPVCGVTISPPAMQCQNGHLLCVDCRIRSERCPVCRDFYTPRRALLAEQI 193
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
sina | NP_001287089.1 |
Sina |
114..310 |
CDD:281181 |
3/9 (33%) |
CG6688 | NP_651110.1 |
PDZ_signaling |
24..104 |
CDD:238492 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3002 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D780610at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.