DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sina and CG6688

DIOPT Version :10

Sequence 1:NP_476725.1 Gene:sina / 39884 FlyBaseID:FBgn0003410 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster


Alignment Length:53 Identity:24/53 - (45%)
Similarity:31/53 - (58%) Gaps:0/53 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 LFECPVCFDYVLPPILQCSSGHLVCVSCRSKLTCCPTCRGPLANIRNLAMEKV 122
            |.|||||...:.||.:||.:|||:||.||.:...||.||......|.|..|::
  Fly   141 LVECPVCGVTISPPAMQCQNGHLLCVDCRIRSERCPVCRDFYTPRRALLAEQI 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sinaNP_476725.1 RING_Ubox 68..118 CDD:473075 22/47 (47%)
Sina 114..310 CDD:460824 3/9 (33%)
CG6688NP_651110.1 PDZ_canonical 25..104 CDD:483948
RING-HC_SIAHs 143..179 CDD:438233 18/35 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.