DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sina and Siah2

DIOPT Version :9

Sequence 1:NP_001287089.1 Gene:sina / 39884 FlyBaseID:FBgn0003410 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_033200.2 Gene:Siah2 / 20439 MGIID:108062 Length:325 Species:Mus musculus


Alignment Length:305 Identity:222/305 - (72%)
Similarity:247/305 - (80%) Gaps:15/305 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PTAAAAGAGATGVATNTSTSTGSSSAGNTSSANTSSSSSSSLSSAGGGDAGMSA---DLTSLFEC 73
            |:.||..|.||           .|:||..|||..::::..|...||||...:|.   :|||||||
Mouse    28 PSPAAPPAAAT-----------ISAAGPGSSAVPAAAAVISGPGAGGGADPVSPQHHELTSLFEC 81

  Fly    74 PVCFDYVLPPILQCSSGHLVCVSCRSKLTCCPTCRGPLA-NIRNLAMEKVASNVKFPCKHSGYGC 137
            ||||||||||||||.:|||||..||.||:|||||||.|. :|||||||||||.|.||||::..||
Mouse    82 PVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTPSIRNLAMEKVASAVLFPCKYATTGC 146

  Fly   138 TASLVYTEKTEHEETCECRPYLCPCPGASCKWQGPLDLVMQHLMMSHKSITTLQGEDIVFLATDI 202
            :.:|.:|||.|||:.||.|||.||||||||||||.|:.||.|||.:|||||||||||||||||||
Mouse   147 SLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDI 211

  Fly   203 NLPGAVDWVMMQSCFGHHFMLVLEKQEKYDGHQQFFAIVQLIGSRKEAENFVYRLELNGNRRRLT 267
            |||||||||||||||||||||||||||||:|||||||||.|||:||:||||.|||||||||||||
Mouse   212 NLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLT 276

  Fly   268 WEAMPRSIHEGVASAIHNSDCLVFDTSIAQLFADNGNLGINVTIS 312
            |||.|||||:|||:||.|||||||||:||.|||||||||||||||
Mouse   277 WEATPRSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTIS 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sinaNP_001287089.1 Sina 114..310 CDD:281181 162/195 (83%)
Siah2NP_033200.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 7/25 (28%)
Sina 123..319 CDD:281181 162/195 (83%)
SBD. /evidence=ECO:0000250|UniProtKB:P61092 131..323 158/191 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848768
Domainoid 1 1.000 349 1.000 Domainoid score I1022
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 449 1.000 Inparanoid score I1604
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60089
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001170
OrthoInspector 1 1.000 - - otm43660
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45877
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X796
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.860

Return to query results.
Submit another query.