DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sina and Siah1b

DIOPT Version :9

Sequence 1:NP_001287089.1 Gene:sina / 39884 FlyBaseID:FBgn0003410 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001295314.1 Gene:Siah1b / 20438 MGIID:108063 Length:282 Species:Mus musculus


Alignment Length:289 Identity:217/289 - (75%)
Similarity:237/289 - (82%) Gaps:13/289 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ATNTSTSTGSSSAGNTSSANTSSSSSSSLSSAGGGDAGMSADLTSLFECPVCFDYVLPPILQCSS 89
            ||..||.|..........|.|.:::|::             ||.|||||||||||||||||||.|
Mouse     6 ATALSTGTSKCPPSQRVPALTDTTASNN-------------DLASLFECPVCFDYVLPPILQCQS 57

  Fly    90 GHLVCVSCRSKLTCCPTCRGPLANIRNLAMEKVASNVKFPCKHSGYGCTASLVYTEKTEHEETCE 154
            |||||.:||.||||||||||||.:||||||||||::|.||||:|..||..:|.:|:|.||||.||
Mouse    58 GHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYSASGCEITLPHTKKAEHEELCE 122

  Fly   155 CRPYLCPCPGASCKWQGPLDLVMQHLMMSHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGH 219
            .|||.||||||||||||.||.||.|||..|||||||||||||||||||||||||||||||||||.
Mouse   123 FRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGF 187

  Fly   220 HFMLVLEKQEKYDGHQQFFAIVQLIGSRKEAENFVYRLELNGNRRRLTWEAMPRSIHEGVASAIH 284
            ||||||||||||||||||||||||||:||:||||.|||||||:||||||||.|||||||:|:||.
Mouse   188 HFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIM 252

  Fly   285 NSDCLVFDTSIAQLFADNGNLGINVTISL 313
            ||||||||||||||||:|||||||||||:
Mouse   253 NSDCLVFDTSIAQLFAENGNLGINVTISM 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sinaNP_001287089.1 Sina 114..310 CDD:281181 164/195 (84%)
Siah1bNP_001295314.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23 5/16 (31%)
Sina 82..278 CDD:281181 164/195 (84%)
SBD 90..282 160/192 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 349 1.000 Domainoid score I1022
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 449 1.000 Inparanoid score I1604
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60089
OrthoDB 1 1.010 - - D780610at2759
OrthoFinder 1 1.000 - - FOG0001170
OrthoInspector 1 1.000 - - otm43660
orthoMCL 1 0.900 - - OOG6_104798
Panther 1 1.100 - - O PTHR45877
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X796
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.