DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sina and siah3

DIOPT Version :9

Sequence 1:NP_001287089.1 Gene:sina / 39884 FlyBaseID:FBgn0003410 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_002941011.1 Gene:siah3 / 100497552 XenbaseID:XB-GENE-6035790 Length:241 Species:Xenopus tropicalis


Alignment Length:233 Identity:104/233 - (44%)
Similarity:139/233 - (59%) Gaps:40/233 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 SSGHLVCVSCRSKLTCCPTCRGPLANIRNLAMEKVASNVKFPCKHSGYGCTASLVYTE-KTEHEE 151
            |:|.||||.            .|..|::|                   |...|.|..| .:|.:|
 Frog    30 SAGQLVCVV------------NPTQNLQN-------------------GSNRSAVPEEDSSERKE 63

  Fly   152 TCECR-----PYL--CPCPGASCKWQGPLDLVMQHLMMSHKSITTLQGEDIVFLATDINLPGAVD 209
            ...||     |.|  |.||..||||:|.|::::.||..|| :|..|.|.:|||||||::||..||
 Frog    64 QYLCRQSVNDPQLTSCTCPLYSCKWEGHLEVIVSHLTQSH-TINILHGTEIVFLATDMHLPAPVD 127

  Fly   210 WVMMQSCFGHHFMLVLEKQEKYDGHQQFFAIVQLIGSRKEAENFVYRLELNGNRRRLTWEAMPRS 274
            |::..||.||||:|||.|||||.|:.||||.:.|||:..:|:||.|:||||.|||:||||:.|||
 Frog   128 WIITHSCLGHHFLLVLRKQEKYQGYPQFFATMMLIGTSAQAQNFNYKLELNRNRRKLTWESTPRS 192

  Fly   275 IHEGVASAIHNSDCLVFDTSIAQLFADNGNLGINVTIS 312
            :.:.|.|.|.:.|||:.:.|:||||:|||:|.|.:.|:
 Frog   193 VFDCVDSVITDGDCLILNASVAQLFSDNGSLAIGIAIA 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sinaNP_001287089.1 Sina 114..310 CDD:281181 95/203 (47%)
siah3XP_002941011.1 Sina 105..229 CDD:239753 71/123 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780610at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.