DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sina and siah2

DIOPT Version :9

Sequence 1:NP_001287089.1 Gene:sina / 39884 FlyBaseID:FBgn0003410 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001095281.1 Gene:siah2 / 100124319 XenbaseID:XB-GENE-1004950 Length:318 Species:Xenopus tropicalis


Alignment Length:307 Identity:214/307 - (69%)
Similarity:237/307 - (77%) Gaps:15/307 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PKRREPTAAAAGAGATGVATNTSTSTGSSSAGNTSSANTSSSSSSSLSSAGGGDAGMSADLTSLF 71
            |....|.||:....||       .|.|..|:.....|..:::.:..||.       ...:|||||
 Frog    22 PPPPPPHAASLSLPAT-------ISGGPGSSAPPPPAAAAAAITGPLSQ-------QHQELTSLF 72

  Fly    72 ECPVCFDYVLPPILQCSSGHLVCVSCRSKLTCCPTCRGPLA-NIRNLAMEKVASNVKFPCKHSGY 135
            ||||||||||||||||.:|||||..||.||:||||||..|. :|||||||||||.|.||||::..
 Frog    73 ECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRASLTPSIRNLAMEKVASAVLFPCKYAST 137

  Fly   136 GCTASLVYTEKTEHEETCECRPYLCPCPGASCKWQGPLDLVMQHLMMSHKSITTLQGEDIVFLAT 200
            ||:.||.:|||.|||:.||.|||.||||||||||||.|:.|||||..||||||||||||||||||
 Frog   138 GCSLSLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLENVMQHLTHSHKSITTLQGEDIVFLAT 202

  Fly   201 DINLPGAVDWVMMQSCFGHHFMLVLEKQEKYDGHQQFFAIVQLIGSRKEAENFVYRLELNGNRRR 265
            ||||||||||||||.||.|||||||||||||:|||||||||.|||:||:|||:.|||||||||||
 Frog   203 DINLPGAVDWVMMQYCFNHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENYAYRLELNGNRRR 267

  Fly   266 LTWEAMPRSIHEGVASAIHNSDCLVFDTSIAQLFADNGNLGINVTIS 312
            |||||.|||||:|||:||.|||||||||:||.|||||||||||||||
 Frog   268 LTWEATPRSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTIS 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sinaNP_001287089.1 Sina 114..310 CDD:281181 161/195 (83%)
siah2NP_001095281.1 RING_Ubox 72..109 CDD:418438 30/36 (83%)
Sina 116..312 CDD:397316 161/195 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 348 1.000 Domainoid score I1028
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780610at2759
OrthoFinder 1 1.000 - - FOG0001170
OrthoInspector 1 1.000 - - otm48831
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X796
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.