DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zcchc7 and GIS2

DIOPT Version :9

Sequence 1:NP_648926.3 Gene:Zcchc7 / 39883 FlyBaseID:FBgn0036668 Length:1734 Species:Drosophila melanogaster
Sequence 2:NP_014144.1 Gene:GIS2 / 855466 SGDID:S000005199 Length:153 Species:Saccharomyces cerevisiae


Alignment Length:99 Identity:32/99 - (32%)
Similarity:38/99 - (38%) Gaps:14/99 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   842 CPVARPRSHAKCSNCFEMGHVRSKCPRPRKPLVCFICGTMGHAEPRCP---------NAICFGCG 897
            |.:.|.....:|.||.|.|||||:|...|    ||.|...||....||         ...|:.||
Yeast    38 CTMPRTVEFKQCYNCGETGHVRSECTVQR----CFNCNQTGHISRECPEPKKTSRFSKVSCYKCG 98

  Fly   898 SKQEIYVQQCNKCSFHSRLVCQLCKMRGHGVDHC 931
            ....: .:.|.|....|.|.|..|...||....|
Yeast    99 GPNHM-AKDCMKEDGISGLKCYTCGQAGHMSRDC 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zcchc7NP_648926.3 PTZ00368 827..937 CDD:173561 32/99 (32%)
GIS2NP_014144.1 AIR1 <1..129 CDD:227414 31/95 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.