DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zcchc7 and AIR1

DIOPT Version :9

Sequence 1:NP_648926.3 Gene:Zcchc7 / 39883 FlyBaseID:FBgn0036668 Length:1734 Species:Drosophila melanogaster
Sequence 2:NP_012186.1 Gene:AIR1 / 854731 SGDID:S000001341 Length:360 Species:Saccharomyces cerevisiae


Alignment Length:461 Identity:94/461 - (20%)
Similarity:153/461 - (33%) Gaps:150/461 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   745 TTVRSDEDIDASNDLEETNPDKNDRDVTNE---EQHVHVEHNLQELRDESLPKSGDLIGWNEEMR 806
            |.:...|.||....:::|.|..:|....|:   .....|:.|.:|||  :|...|...|..:   
Yeast     3 TLLSEVESIDTLPYVKDTTPTGSDSSSFNKLLAPSIEDVDANPEELR--TLRGQGRYFGITD--- 62

  Fly   807 SFYNDSWNGENFSVHKVQRMMTGHRHEWRINTADRCPVARPRSHAKCSNCFEMGHVRSKCPRPRK 871
               .|| ||                             |...:..||:||.:.||::..||.   
Yeast    63 ---YDS-NG-----------------------------AIMEAEPKCNNCSQRGHLKRNCPH--- 91

  Fly   872 PLVCFICGTM-GHAEPRCPNA-ICFGCGSKQEIYVQQCNKCSFH--SRLVCQLCKMRGHGVDHCP 932
             ::|..||.| .|....||.| ||..|.:... |..||.    |  .::.|.||..:.|..:.||
Yeast    92 -VICTYCGFMDDHYSQHCPKAIICTNCNANGH-YKSQCP----HKWKKVFCTLCNSKRHSRERCP 150

  Fly   933 DKWRRYHSTTRSNTELDSRVQYRSVQCSYC--AGRHSFENCRQR-------------IGDFRSTN 982
            ..||.|...|:...:.|  ..:::|.|..|  || |..::|.:|             .||..:|.
Yeast   151 SIWRSYLLKTKDANQGD--FDFQTVFCYNCGNAG-HFGDDCAERRSSRVPNTDGSAFCGDNLATK 212

  Fly   983 YTSQIVSHQKIYKNRGGPIGNLGDLKSFFAIETPFH---------------FKWNNPSMPKNCYY 1032
            :.....:..|.||.......:..:...|..::..::               .||.          
Yeast   213 FKQHYFNQLKDYKREASQRQHFDNEHEFNLLDYEYNDDAYDLPGSRTYRDKMKWK---------- 267

  Fly  1033 SRFLVNANLAKVQSVKRKSTTAVSQIPEKIYTHEYVPNAQVKAARGEVSTGTAKKPLTKQMPVVE 1097
                     .||||.:.|:::          .:.|                             |
Yeast   268 ---------GKVQSTRNKNSS----------NNRY-----------------------------E 284

  Fly  1098 SIAENRTAEEPIGKLNREDEKSKDILPLP-EVPPEVKQTQDEKLVEGQPNQSQPDEELPMKDDDQ 1161
            | :.||..:.|....|.:..|:|.:...| :.|   :.:|:.:..:.....|...::.|....::
Yeast   285 S-SNNRKKKSPFSAQNYKVTKNKRVQTHPLDFP---RSSQNNRTNDYSSQFSYNRDDFPKGPKNK 345

  Fly  1162 EEPSSS 1167
            ...|||
Yeast   346 RGRSSS 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zcchc7NP_648926.3 PTZ00368 827..937 CDD:173561 31/113 (27%)
AIR1NP_012186.1 AIR1 9..220 CDD:227414 65/260 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5889
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46955
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8896
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.880

Return to query results.
Submit another query.