DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zcchc7 and AIR2

DIOPT Version :9

Sequence 1:NP_648926.3 Gene:Zcchc7 / 39883 FlyBaseID:FBgn0036668 Length:1734 Species:Drosophila melanogaster
Sequence 2:NP_010106.1 Gene:AIR2 / 851379 SGDID:S000002334 Length:344 Species:Saccharomyces cerevisiae


Alignment Length:302 Identity:64/302 - (21%)
Similarity:108/302 - (35%) Gaps:76/302 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   825 RMMTGHRHEWRINTADRCPV--ARPRSHAKCSNCFEMGHVRSKCPRPRKPLVCFICG-TMGHAEP 886
            |.:.|....:.::..|:..:  |.|    ||:||.:.||::..||.    ::|..|| |..|...
Yeast    37 RALRGQGRYFGVSDDDKDAIKEAAP----KCNNCSQRGHLKKDCPH----IICSYCGATDDHYSR 93

  Fly   887 RCPNAICFGCGSKQEIYVQQCNKCS----FHS-------RLVCQLCKMRGHGVDHCPDKWRRYHS 940
            .||.||             ||:||.    :.|       ::.|.|||.:.|..:.||..||.|..
Yeast    94 HCPKAI-------------QCSKCDEVGHYRSQCPHKWKKVQCTLCKSKKHSKERCPSIWRAYIL 145

  Fly   941 TTRSNTELDSRVQYRSVQCSYCAGR-HSFENCRQRIGD---------FRSTNYTSQIVSHQKIYK 995
            ...:.......:.:.::.|..|.|: |..::|:::...         |..:|.:.::......:.
Yeast   146 VDDNEKAKPKVLPFHTIYCYNCGGKGHFGDDCKEKRSSRVPNEDGSAFTGSNLSVELKQEYYRHM 210

  Fly   996 NRGGPIGNLGDLKSFFAIETP--------------------------FH---FKWNNPSMPKNCY 1031
            ||................|.|                          ||   ::.:|...| ...
Yeast   211 NRNSDENEDYQFSESIYDEDPLPRPSHKRHSQNDHSHSGRNKRRASNFHPPPYQKSNVIQP-TIR 274

  Fly  1032 YSRFLVNANLAKVQSVKRKSTTAVSQIPEKIYTHEYVPNAQV 1073
            .....:|.|::| .|..:.:...||.|.|.:|...|.|:..|
Yeast   275 GETLSLNNNISK-NSRYQNTKVNVSSISENMYGSRYNPSTYV 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zcchc7NP_648926.3 PTZ00368 827..937 CDD:173561 34/123 (28%)
AIR2NP_010106.1 AIR1 1..209 CDD:227414 44/192 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46955
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR46543
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8896
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.