DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zcchc7 and CNBP

DIOPT Version :10

Sequence 1:NP_648926.3 Gene:Zcchc7 / 39883 FlyBaseID:FBgn0036668 Length:1734 Species:Drosophila melanogaster
Sequence 2:NP_001120664.1 Gene:CNBP / 7555 HGNCID:13164 Length:179 Species:Homo sapiens


Alignment Length:140 Identity:33/140 - (23%)
Similarity:47/140 - (33%) Gaps:29/140 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   792 LPKSGDLIGWNEEMRSFYNDSWNGENFSVHKVQRMMTGHRHEWRINTADRCPVARPRSHAKCSNC 856
            |.|..||   .|::.:.||....|                     :.|..|...:......|.||
Human    63 LAKDCDL---QEDVEACYNCGRGG---------------------HIAKDCKEPKREREQCCYNC 103

  Fly   857 FEMGHVRSKCPRPRKPLVCFICGTMGHAEPRCPNAICFGCGSKQEIYVQQCNKCSFHSRLVCQLC 921
            .:.||:...|....:. .|:.||..||.:..|....|:.||....:.:    .||..|.:.|..|
Human   104 GKPGHLARDCDHADEQ-KCYSCGEFGHIQKDCTKVKCYRCGETGHVAI----NCSKTSEVNCYRC 163

  Fly   922 KMRGHGVDHC 931
            ...||....|
Human   164 GESGHLAREC 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zcchc7NP_648926.3 PTZ00368 827..937 CDD:173561 25/105 (24%)
CNBPNP_001120664.1 RNA-binding Arg/Gly-rich region (RGG-box). /evidence=ECO:0000269|PubMed:28329689 25..38
PTZ00368 54..173 CDD:173561 32/138 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.