DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zcchc7 and Zcchc3

DIOPT Version :9

Sequence 1:NP_648926.3 Gene:Zcchc7 / 39883 FlyBaseID:FBgn0036668 Length:1734 Species:Drosophila melanogaster
Sequence 2:XP_001072887.2 Gene:Zcchc3 / 690005 RGDID:1585203 Length:400 Species:Rattus norvegicus


Alignment Length:468 Identity:106/468 - (22%)
Similarity:161/468 - (34%) Gaps:157/468 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   530 PTIIRNVDSSSGSSSVEE------VVEPSVQKTKRLRKRSCSTNNHSQSDPNNDDGLDDSDSDDG 588
            |...|.|..:..|..|.|      ||:...:|....|:    .....::......||..|.|...
  Rat    19 PLPARPVARAEESEGVREKMGWAQVVKNLAEKKGDFRE----PRRRDEAGSGASGGLGSSGSLAA 79

  Fly   589 VHATGVPGIARGMAVERCKRKIRRISTRHSSDDNSKKAA------TRIQKPKVAA-----VHHAS 642
            .:....|..|||....|     ||..|..::|...||.|      :|.:|..|:|     ....:
  Rat    80 PNPGDFPPAARGDPKGR-----RRDPTGEAADAYRKKGASSAGDPSRRKKADVSAAMPTPARSGA 139

  Fly   643 SESASE----DELPSARDIAERLLNQQQGQGKVQVQ-KGDGDDDAI-------------SIGSDE 689
            :|.|:|    ||.|:|          ..|:|:..|: ...||:.|.             |||.|.
  Rat   140 TEDATERPLQDEPPAA----------GPGKGRFLVRICFQGDESACPTRDFVVGALILRSIGMDP 194

  Fly   690 DS-----------HAEAEFRDAMTDRLAAVFERLDAKAKKMEEDEEQVNASGYISDEEDSRDKSA 743
            |.           ..:..||.|  ::| |:|.|:..:.:::|:..|.....|        |.||:
  Rat   195 DDIYAVIQIPGSREFDVSFRSA--EKL-ALFLRVYEEKRELEDCWENFVVLG--------RSKSS 248

  Fly   744 DTTV----RSDEDIDASNDLEETNPDKNDRDVTNEEQHVHVEHNLQELRDESLP-KSGDLIGWNE 803
            ..|:    |::     :.|:|:.        ||..::|..|         .::| |..|..|   
  Rat   249 LKTLFILFRNE-----TVDVEDI--------VTWLKRHCDV---------LAVPVKVTDRFG--- 288

  Fly   804 EMRSFYNDSWNGENFSVHKVQRMMTGHRH-------------EWRINTADRCPVARPRSHA---- 851
                    .|.||.....::::...|.||             .|.......|.....|:|.    
  Rat   289 --------IWTGEYKCEIELRQGEGGVRHLPGAFFLGAERGYSWYKGQPKTCFKCGSRTHMSGTC 345

  Fly   852 ---KCSNCFEMGHVRSKCPRPRKPLVCFICGTMGHAEPRCPNAICFGCGSKQEIYVQQCNKCSFH 913
               :|..|.|.||:...|   ||.:||.:||..|||..:||.|:                    |
  Rat   346 TQDRCFRCGEEGHLSPYC---RKVIVCNLCGKRGHAFAQCPKAV--------------------H 387

  Fly   914 SRLVCQLCKMRGH 926
            :.:..||..:.||
  Rat   388 NSMAAQLTGLAGH 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zcchc7NP_648926.3 PTZ00368 827..937 CDD:173561 30/120 (25%)
Zcchc3XP_001072887.2 PRK07003 <80..>161 CDD:235906 24/95 (25%)
AIR1 <330..>383 CDD:227414 18/55 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.