DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zcchc7 and Zcchc3

DIOPT Version :9

Sequence 1:NP_648926.3 Gene:Zcchc7 / 39883 FlyBaseID:FBgn0036668 Length:1734 Species:Drosophila melanogaster
Sequence 2:NP_780335.1 Gene:Zcchc3 / 67917 MGIID:1915167 Length:400 Species:Mus musculus


Alignment Length:459 Identity:105/459 - (22%)
Similarity:158/459 - (34%) Gaps:160/459 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   545 VEEVVEPS--------VQKTKRLRKRSCSTNNHSQSDPNNDDGLDDSDSDDGVHATGVPG----I 597
            |..|.||.        .|..|.|.::........:.|...........|..|: ||..||    .
Mouse    25 VARVEEPEGVREKMGWAQVVKNLAEKKGDFREPRRRDETGSGASGGLGSPGGL-ATPNPGDFPPA 88

  Fly   598 ARGMAVERCKRKIRRISTRHSSDDNSKKAA------TRIQKPKVAA-----VHHASSESASE--- 648
            |||....|     ||..|..:||...||:|      :|.:|.:|.|     ....::|.|:|   
Mouse    89 ARGDPKGR-----RRDPTGEASDAYRKKSASGAGDPSRRKKAEVTAAMATPARPGTTEDATERPL 148

  Fly   649 -DELPSARDIAERLLNQQQGQGKVQVQ-KGDGDDDAI-------------SIGSDEDS------- 691
             ||.|:|          ..|:|:..|: ...||:.|.             |||.|.|.       
Mouse   149 QDEPPAA----------GPGKGRFLVRICFQGDESACPTRDFVVGALILRSIGMDPDDIYAVIQI 203

  Fly   692 ----HAEAEFRDAMTDRLAAVFERLDAKAKKMEEDEEQVNASGYISDEEDSRDKSADTTV----R 748
                ..:..||.|  ::| |:|.|:..:.:::|:..|.....|        |.:|:..|:    |
Mouse   204 PGSREFDVSFRSA--EKL-ALFLRVYEEKRELEDCWENFVVLG--------RSRSSLKTLFILFR 257

  Fly   749 SDEDIDASNDLEETNPDKNDRDVTNEEQHVHVEHNLQELRDESLP-KSGDLIGWNEEMRSFYNDS 812
            ::     :.|:|:.        ||..::|..|         .::| |..|..|           .
Mouse   258 NE-----TVDVEDI--------VTWLKRHCDV---------LAVPVKVTDRFG-----------I 289

  Fly   813 WNGENFSVHKVQRMMTGHRH-------------EWRINTADRCPVARPRSHA-------KCSNCF 857
            |.||.....::::...|.||             .|.......|.....|:|.       :|..|.
Mouse   290 WTGEYKCEIELRQGEGGVRHLPGAFFLGAERGYSWYKGQPKTCFKCGSRTHMSGTCTQDRCFRCG 354

  Fly   858 EMGHVRSKCPRPRKPLVCFICGTMGHAEPRCPNAICFGCGSKQEIYVQQCNKCSFHSRLVCQLCK 922
            |.||:...|   ||.:||.:||..|||..:||.|:                    |:.:..||..
Mouse   355 EEGHLSPYC---RKVIVCNLCGKRGHAFAQCPKAV--------------------HNSVTAQLTS 396

  Fly   923 MRGH 926
            :.||
Mouse   397 VAGH 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zcchc7NP_648926.3 PTZ00368 827..937 CDD:173561 30/120 (25%)
Zcchc3NP_780335.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..157 37/147 (25%)
AIR1 <330..>383 CDD:227414 18/55 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.