DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zcchc7 and CNBP

DIOPT Version :9

Sequence 1:NP_648926.3 Gene:Zcchc7 / 39883 FlyBaseID:FBgn0036668 Length:1734 Species:Drosophila melanogaster
Sequence 2:NP_001188992.1 Gene:CNBP / 37646 FlyBaseID:FBgn0034802 Length:165 Species:Drosophila melanogaster


Alignment Length:125 Identity:29/125 - (23%)
Similarity:49/125 - (39%) Gaps:17/125 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   848 RSHAKCSNCFEMGHVRSKCPRPRKPLVCFICGTMGHAEPRC---PNAICFGCGSKQEIYVQQCNK 909
            |:..||..|.:.||....||...:.  |:.|..:||....|   .|..|:.| :|...:|:.|.:
  Fly    52 RNREKCYKCNQFGHFARACPEEAER--CYRCNGIGHISKDCTQADNPTCYRC-NKTGHWVRNCPE 113

  Fly   910 CSFH---SRLVCQLCKMRGHGVDHCPDKWRRYHSTTRSNTELDSRVQYRSVQCSYCAGRH 966
            ....   :.:.|..|...||...:||:..:..:...:|.        :...:|....||:
  Fly   114 AVNERGPTNVSCYKCNRTGHISKNCPETSKTCYGCGKSG--------HLRRECDEKGGRN 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zcchc7NP_648926.3 PTZ00368 827..937 CDD:173561 25/94 (27%)
CNBPNP_001188992.1 PTZ00368 6..161 CDD:173561 27/119 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5082
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.