DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zcchc7 and Zcchc14

DIOPT Version :9

Sequence 1:NP_648926.3 Gene:Zcchc7 / 39883 FlyBaseID:FBgn0036668 Length:1734 Species:Drosophila melanogaster
Sequence 2:XP_344781.5 Gene:Zcchc14 / 365018 RGDID:1309494 Length:1087 Species:Rattus norvegicus


Alignment Length:456 Identity:91/456 - (19%)
Similarity:152/456 - (33%) Gaps:131/456 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DLEEMDSER--LNELESILYASIHYSDGF-----EEHTAMDQPAKESTSDQDARSMPPPPQQKHP 60
            :||:..|||  ||...    .|:..|.|.     ..|....||.:.|.:.:....:.||   .|.
  Rat   495 ELEKEKSERRCLNSSA----PSLVTSSGVARVTPTSHVGPVQPGRSSHASELRVEVEPP---AHQ 552

  Fly    61 IPGQRFVSGTRVINNSMQKPRYWIDGAAAVGEGQVVQAEEQQATTNKTMPAVEESSSSQSMDVDM 125
            :|.:...|            .|....::.:|    |||.|:.:      .:.|||.....:.|:.
  Rat   553 LPREGSSS------------EYSSSSSSPMG----VQAREESS------DSAEESDRRVDIHVEG 595

  Fly   126 PQDKS--LLLSPEKGTSNQP---------KTASQPPKHQQIPQAKQQQNIHAKQLQNQQAKPQEQ 179
            .:.:.  :||:....:|.:|         :|.|.|..|..:|........|        ..|...
  Rat   596 TEKEKPVMLLAHFPSSSARPTAQVLPVQNETGSSPAGHHPLPAQLMPAAPH--------LAPVRM 652

  Fly   180 KNSQQKQQQ-----SLKQQNQQSKQHQNQQKKSAPVVQKPKPQPNASTKVNHEAYEAERFDQRLL 239
            .||..|..:     .|...:..|.....::.|.        |.|.:.|||:      :.|...:|
  Rat   653 LNSVHKSDRGSTDVKLLSSSVHSLLSLEERGKG--------PAPRSGTKVD------KSFGGAVL 703

  Fly   240 VAIPPNCPPKKQNKPQQNKQQQQQNKQQQKKQQQSLQHNKQQQQSGPGPFGKANRKLEQIQRLAD 304
            ..:|...|    :.|.|......:|        .|:..|...     ||..|.            
  Rat   704 DTLPSAAP----HPPVQGLSGLVEN--------TSVSPNVSF-----GPRAKV------------ 739

  Fly   305 KKQKSKQAQLNKKQRKQQSPPVEFVNLAETSESS--DDDDVVHVPLPPAPI-----IELDTS-DG 361
                ...|.|::..:..|.|.:    ..|||.::  ....|:||..||..:     :..||: .|
  Rat   740 ----VHAATLDRVLKTAQQPAL----TVETSSAATGTPSTVLHVARPPIKLLLSSSVPADTAISG 796

  Fly   362 EQTCTSS-------QLFHEENAMDATDVKMGLSCITEP-----EGTSVVASSTTPPMHSPSCSVM 414
            :.:|.::       .:.:..||:...:.|:..|.::..     :|:....|:|..|...||.|..
  Rat   797 QTSCPNNGQISVPPAILNPRNALYTANTKVAFSAVSSVPVGPLQGSFCANSNTASPSSHPSTSFA 861

  Fly   415 S 415
            |
  Rat   862 S 862

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zcchc7NP_648926.3 PTZ00368 827..937 CDD:173561
Zcchc14XP_344781.5 PX_domain 261..342 CDD:295365
SAM_ZCCH14 437..501 CDD:188957 2/5 (40%)
SAM 444..495 CDD:197735 91/456 (20%)
zf-CCHC 1046..1061 CDD:278525
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.