DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zcchc7 and cnbpb

DIOPT Version :9

Sequence 1:NP_648926.3 Gene:Zcchc7 / 39883 FlyBaseID:FBgn0036668 Length:1734 Species:Drosophila melanogaster
Sequence 2:NP_001313334.1 Gene:cnbpb / 335839 ZFINID:ZDB-GENE-030131-7782 Length:161 Species:Danio rerio


Alignment Length:155 Identity:38/155 - (24%)
Similarity:46/155 - (29%) Gaps:62/155 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   828 TGHRHEWRINTADRCP--------------------------VAR--PRSHAKCSNCFEMGHVRS 864
            |||   |..|    ||                          |||  .|:...|.||...||:..
Zfish    12 TGH---WIKN----CPNAGRGRGKGRGRGKDLFCYRCGEPGHVARDCERTEDACYNCGRGGHISR 69

  Fly   865 KCPRPRK-----------------------PLVCFICGTMGHAEPRCPNAICFGCGSKQEIYVQQ 906
            .|..|:|                       ...|:.||..||.:..|....|:.||....:.|| 
Zfish    70 DCKEPKKEREQVCYNCGKAGHMARDCDHANEQKCYSCGGFGHIQKGCEKVKCYRCGEIGHVAVQ- 133

  Fly   907 CNKCSFHSRLVCQLCKMRGHGVDHC 931
               ||..|.:.|..|...||....|
Zfish   134 ---CSKASEVNCYNCGKSGHVAKEC 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zcchc7NP_648926.3 PTZ00368 827..937 CDD:173561 38/155 (25%)
cnbpbNP_001313334.1 COG5222 <6..>20 CDD:227547 5/14 (36%)
PTZ00368 38..155 CDD:173561 30/120 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.