DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zcchc7 and Zcchc2

DIOPT Version :9

Sequence 1:NP_648926.3 Gene:Zcchc7 / 39883 FlyBaseID:FBgn0036668 Length:1734 Species:Drosophila melanogaster
Sequence 2:NP_001116149.2 Gene:Zcchc2 / 304695 RGDID:1310626 Length:1169 Species:Rattus norvegicus


Alignment Length:570 Identity:99/570 - (17%)
Similarity:200/570 - (35%) Gaps:185/570 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ASIHYSDGFEEHTAMDQPAKESTSDQDARSMPPPPQQKHPIPGQRFVSGTRVINNSMQKPRYWID 85
            ||:|.:..|.:...:.:..:...|   |..:.|...:..|   ..| :|:|..|:|         
  Rat   263 ASLHPAFSFHQRVTLREHLERLRS---ALRVEPEDAEVEP---SNF-AGSRAQNDS--------- 311

  Fly    86 GAAAVGEGQVVQAEEQQATTNKTMPAVEESSSSQSMDVDMPQDKSLLLSPEKGTSNQPKTASQPP 150
                 ..|..:|:.|        ...||::        .:||| .|.::|.:.            
  Rat   312 -----ACGDYIQSNE--------TGLVEQA--------QIPQD-GLTVAPHRA------------ 342

  Fly   151 KHQQIPQAKQQQNIHAKQLQNQQAKPQEQKNSQQKQQQSLK------QQNQQSKQHQNQQKKSAP 209
                     |::.:|.:::   ..|..:::.:.:..:.:.|      .....:|.||..|:.   
  Rat   343 ---------QREAVHIEKI---MLKGVQRRRADKYWEYTFKVNWSDLSVTTVTKTHQELQEF--- 392

  Fly   210 VVQKPKPQPNASTKVNHEAYEAERFDQRLLVAIPPNCPPKKQNKPQQNKQQQQQNKQQQKKQQQS 274
            :::.||            .:.:|.||:.:|.|:                  .|.:.::::::...
  Rat   393 LLKLPK------------EFSSESFDKTILKAL------------------NQGSLRREERRHPD 427

  Fly   275 LQH-NKQQQQSGPGPFGKANRKLEQIQRLADKKQKSKQAQLNKKQRKQQSPPVEFVNLAETSESS 338
            |:. .:|...:.|..|.::::.....:.::.:.|.|..   |.:...:.|..:|.:....:..||
  Rat   428 LEPILRQLFSTSPQAFLQSHKVRSFFRSISSESQHSFN---NLQSSLKTSKILEHLKEDSSEASS 489

  Fly   339 DDDDVV--------HVPLPPAPIIELDTSDGEQTCTSSQL-------FHEENAMDATDVKMGLSC 388
            .::||:        |....||         |....||..|       :.|:|.:  .|.:     
  Rat   490 QEEDVLQHTIIHKKHAGKSPA---------GNSVATSCALLEGLTMQYAEQNGV--VDWR----- 538

  Fly   389 ITEPEGTSVVASSTTPPMHSPSCSVMSSDDFIVQKDT--------------TRLLTECENANDED 439
               .:|.:.:       .||..| |.|:|....:|.:              ...:.:.||.....
  Rat   539 ---NQGCAAI-------QHSEHC-VSSADQLSAEKRSLSSVNKKKGKPQVEKEKIKKTENRLSSR 592

  Fly   440 LLVLTETAIREAIGEEPKDKEVVENASEEQEHDHAADTSSEYEFVPPSRLEEIKKNYRVDDQQFR 504
            :..:..:|.:.|.|...||.    |......||...:||||....|.|...:.:::...::::.|
  Rat   593 INGIRLSAPQHAHGSTVKDM----NLDVGSGHDTCGETSSESYSSPSSPRHDGRESLESEEEKDR 653

  Fly   505 ALDVYESESDLTESGIYSKAKSKTTPTIIRNVDSSSGSSSVEEVVEPSVQ 554
                 :::|:..:||..|.|:             .:|..||.:.|  |||
  Rat   654 -----DTDSNSEDSGNPSSAR-------------FAGHGSVTQTV--SVQ 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zcchc7NP_648926.3 PTZ00368 827..937 CDD:173561
Zcchc2NP_001116149.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..87
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 209..242
PX_domain 356..456 CDD:295365 17/132 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 562..694 30/146 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 933..979
zf-CCHC 1124..1139 CDD:278525
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.