DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kud and Tmem258b

DIOPT Version :9

Sequence 1:NP_001246807.1 Gene:kud / 39882 FlyBaseID:FBgn0036667 Length:78 Species:Drosophila melanogaster
Sequence 2:XP_001066513.3 Gene:Tmem258b / 686092 RGDID:1586604 Length:79 Species:Rattus norvegicus


Alignment Length:79 Identity:51/79 - (64%)
Similarity:63/79 - (79%) Gaps:3/79 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDVMQRYVSPVNPAVFPHLATVLLVIGTFFTAWFFIF-VVSRKSSKESTLIKELLISLCASIFLG 64
            ::.|.||.|||||||||||..|||.||.|||||||:: |.|.|.:::  :.|||||||.||:|:|
  Rat     3 LEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRD--VYKELLISLVASLFMG 65

  Fly    65 FGIVFLLLTVGIYV 78
            ||::||||.|||||
  Rat    66 FGVLFLLLWVGIYV 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kudNP_001246807.1 Ost5 5..78 CDD:398770 48/73 (66%)
Tmem258bXP_001066513.3 Ost5 7..79 CDD:398770 48/73 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340661
Domainoid 1 1.000 99 1.000 Domainoid score I6908
eggNOG 1 0.900 - - E1_KOG4452
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 102 1.000 Inparanoid score I4868
OMA 1 1.010 - - QHG54957
OrthoDB 1 1.010 - - D1627291at2759
OrthoFinder 1 1.000 - - FOG0004806
OrthoInspector 1 1.000 - - otm46037
orthoMCL 1 0.900 - - OOG6_105881
Panther 1 1.100 - - LDO PTHR13636
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5140
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.