DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kud and Tmem258

DIOPT Version :9

Sequence 1:NP_001246807.1 Gene:kud / 39882 FlyBaseID:FBgn0036667 Length:78 Species:Drosophila melanogaster
Sequence 2:XP_574622.6 Gene:Tmem258 / 499317 RGDID:1560328 Length:114 Species:Rattus norvegicus


Alignment Length:79 Identity:51/79 - (64%)
Similarity:63/79 - (79%) Gaps:3/79 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDVMQRYVSPVNPAVFPHLATVLLVIGTFFTAWFFIF-VVSRKSSKESTLIKELLISLCASIFLG 64
            ::.|.||.|||||||||||..|||.||.|||||||:: |.|.|.:::  :.|||||||.||:|:|
  Rat    38 LEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRD--VYKELLISLVASLFMG 100

  Fly    65 FGIVFLLLTVGIYV 78
            ||::||||.|||||
  Rat   101 FGVLFLLLWVGIYV 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kudNP_001246807.1 Ost5 5..78 CDD:398770 48/73 (66%)
Tmem258XP_574622.6 Ost5 42..114 CDD:398770 48/73 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1627291at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.