DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TSG101 and AT2G38830

DIOPT Version :9

Sequence 1:NP_524120.1 Gene:TSG101 / 39881 FlyBaseID:FBgn0036666 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_181417.2 Gene:AT2G38830 / 818467 AraportID:AT2G38830 Length:331 Species:Arabidopsis thaliana


Alignment Length:397 Identity:68/397 - (17%)
Similarity:134/397 - (33%) Gaps:140/397 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KKDVVDVVTSFRSLTYDLQRFVFNDGSSKELFTIQGTIPVVYKNNTYYIP---ICIWLMDTHPQN 84
            :|.:..::..:.:.......|..|:|:..:||.::|::.:  :::|..:|   :.||:.:.:|..
plant    38 RKHLTSLLQDYPNFELSTDTFNHNNGAKVQLFCLEGSLRI--RSSTTQLPTVQLTIWIHENYPLT 100

  Fly    85 APMCFVKPTPTMQIKVSMYVDHNGKVYLPYLHDWQPHSSDLLSLIQ-VMIVTFGDHPPVYSKPKE 148
            .|:.|:.|..........:::.:|.....|:..|:....:||..|: :..|...|||.::     
plant   101 PPLVFINPNSIPIRNNHPFINSSGYTKSRYIETWEHPRCNLLDFIRNLKKVLANDHPFLH----- 160

  Fly   149 QIAAPYPTNSYMPQPGAPGGSNSFLPYPTAGGAGGSNFPPYPTGSNVGPYPPTPAGPAGGSGYPA 213
                   |:|.:|                                                    
plant   161 -------TDSLIP---------------------------------------------------- 166

  Fly   214 YPNFIQPTAGGYPPAAGYNPSNPSSTGTITEEHIKASIISAIDDKLRRRVQEKVNQYQAEIETLN 278
                               ..|.|.:.|...:.:..|        |...|...:.:.:.|||.|.
plant   167 -------------------TRNQSVSRTEALDRLATS--------LHYDVLTIMERSEEEIENLW 204

  Fly   279 RTKQELLEGSAKIDAIIERLEREHIDMQKNISILKDKEQ---------------------ELEKA 322
            :.:.|:.:.|..:.:||..||.|...::  :..||.||.                     .:|:.
plant   205 KLQSEVKQRSESVKSIITELEIERGTLK--VRALKLKEDSDVLTTWVEMNYLKLTSMDMGRIEEM 267

  Fly   323 LEDLESAEAINPDEAVTTTAPLYRQLLNAYADEAATEDAIYYLGEGLRGGVIDLETFLKHVRQLS 387
            .|.....|.:..|:|:                    ||.:..|.|....|.:::.::||.||.|:
plant   268 FEIESEVEGLAGDDAI--------------------EDVLRVLEEAAERGELEIGSYLKQVRVLA 312

  Fly   388 RKQFILR 394
            |:||.|:
plant   313 REQFFLK 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TSG101NP_524120.1 UEV 22..140 CDD:283415 23/120 (19%)
ARS2 <149..227 CDD:282772 3/77 (4%)
TBPIP <242..353 CDD:284512 23/131 (18%)
Vps23_core 336..393 CDD:286532 14/56 (25%)
AT2G38830NP_181417.2 UBCc 37..148 CDD:412187 21/111 (19%)
Vps23_core 266..319 CDD:401418 17/72 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2391
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435538at2759
OrthoFinder 1 1.000 - - FOG0001267
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23306
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.