DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TSG101 and Uevld

DIOPT Version :9

Sequence 1:NP_524120.1 Gene:TSG101 / 39881 FlyBaseID:FBgn0036666 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001035785.1 Gene:Uevld / 54122 MGIID:1860490 Length:471 Species:Mus musculus


Alignment Length:184 Identity:66/184 - (35%)
Similarity:97/184 - (52%) Gaps:10/184 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ITKYLSKYKYVAATKKDVVDVVTSFRSLTYDLQRFVFNDGSSKELFTIQGTIPVVYKNNTYYIPI 73
            :.:.|.|||:...|.:::.:|..||....|.:..:||.|.|.|:|....|||||:|:..||.|||
Mouse     8 VRRLLGKYKFRDLTVEELKNVSVSFPHFRYSVDTYVFKDTSQKDLLNFTGTIPVMYQGKTYNIPI 72

  Fly    74 CIWLMDTHPQNAPMCFVKPTPTMQIKVSMYVDHNGKVYLPYLHDWQPHSSDLLSLIQVMIVTFGD 138
            ..|::|:||...|:||:|||..|:|.|..:||..|::|||||.:|....|.::.||:.||..|.:
Mouse    73 RFWILDSHPFAPPICFLKPTANMEISVGKHVDAKGRIYLPYLQNWSHPKSAIVGLIKEMIAKFQE 137

  Fly   139 HPPVYSKPKEQIAAPYPTNSYMPQ----------PGAPGGSNSFLPYPTAGGAG 182
            ..|:||.|....|......:|:.:          .|.....|..|...|..|:|
Mouse   138 ELPLYSIPSSNEAQQVDLLAYITKITEGVSDINSRGWTNHENKILNKITVVGSG 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TSG101NP_524120.1 UEV 22..140 CDD:283415 50/117 (43%)
ARS2 <149..227 CDD:282772 8/44 (18%)
TBPIP <242..353 CDD:284512
Vps23_core 336..393 CDD:286532
UevldNP_001035785.1 UEV 21..138 CDD:283415 50/116 (43%)
PLN02602 177..471 CDD:178212 5/15 (33%)
NADB_Rossmann 183..468 CDD:304358 3/9 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2391
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435538at2759
OrthoFinder 1 1.000 - - FOG0001267
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.