DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TSG101 and tsg101

DIOPT Version :9

Sequence 1:NP_524120.1 Gene:TSG101 / 39881 FlyBaseID:FBgn0036666 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_031755824.1 Gene:tsg101 / 394879 XenbaseID:XB-GENE-6258323 Length:396 Species:Xenopus tropicalis


Alignment Length:420 Identity:200/420 - (47%)
Similarity:273/420 - (65%) Gaps:43/420 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AVEETQITKYLSKYKYVAATKKDVVDV-VTSFRSLTYDLQRFVFNDGSSKELFTIQGTIPVVYKN 66
            |:.|.|:.|.|.||||...:.:::::| |..:|.|...:..:|||||||:||.::.|||||.||.
 Frog     2 ALSEAQLKKLLGKYKYRDLSVREILNVTVPLYRDLKPIMDSYVFNDGSSRELLSLSGTIPVPYKG 66

  Fly    67 NTYYIPICIWLMDTHPQNAPMCFVKPTPTMQIKVSMYVDHNGKVYLPYLHDWQPHSSDLLSLIQV 131
            |||.||||:||:||:|.|.|:||||||.||.||...:||.|||:||||||:|:...||||.|||:
 Frog    67 NTYNIPICLWLLDTYPFNPPICFVKPTSTMTIKTGKHVDANGKIYLPYLHEWKHPPSDLLGLIQI 131

  Fly   132 MIVTFGDHPPVYSKPKEQIAAPYPTNSYMPQPGAPGGSNSFLPYPTAGGAGGSNFPPYPTGSNVG 196
            :||.||:.|||:|  :....||||   ..|..|.|  ::|::|         ...||||..::  
 Frog   132 LIVVFGEEPPVFS--RSTAPAPYP---MYPATGPP--NSSYMP---------GVIPPYPPAAH-- 178

  Fly   197 PYPPTPAGPAGGSGYPAYPNFIQPTAGGYP----------PAAGYNP---SNPSSTGTITEEHIK 248
                 ||.|:|..|:|.|     |.||.||          |.|...|   |.|:..|||.|:.|:
 Frog   179 -----PANPSGYGGFPGY-----PPAGQYPQTSGPQIFPQPPAAQPPVTSSGPARDGTIGEDTIR 233

  Fly   249 ASIISAIDDKLRRRVQEKVNQYQAEIETLNRTKQELLEGSAKIDAIIERLEREHIDMQKNISILK 313
            ||:|||:.||||.|::|::::.|||:..|.||:::|.:|..|::.::.|||:|..::.|||..|:
 Frog   234 ASLISAVSDKLRWRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLEQEVTEVDKNIETLR 298

  Fly   314 DKEQELEKALEDLES-AEAINPDEAVTTTAPLYRQLLNAYADEAATEDAIYYLGEGLRGGVIDLE 377
            .|::||...:|.:|| :|..:.||.:..|||||:|:||.||:|.|.||.|:||||.||.|||||:
 Frog   299 KKDEELGVVVEKMESQSEYRDIDEVIVPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLD 363

  Fly   378 TFLKHVRQLSRKQFILRATMQKCRQKAGLA 407
            .||||||.||||||.|||.|||.|:.|||:
 Frog   364 VFLKHVRLLSRKQFQLRALMQKARKTAGLS 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TSG101NP_524120.1 UEV 22..140 CDD:283415 67/118 (57%)
ARS2 <149..227 CDD:282772 25/87 (29%)
TBPIP <242..353 CDD:284512 48/111 (43%)
Vps23_core 336..393 CDD:286532 39/56 (70%)
tsg101XP_031755824.1 UEV 22..140 CDD:399041 67/117 (57%)
GrpE 193..>312 CDD:413575 46/118 (39%)
DUF1640 <242..298 CDD:400241 22/55 (40%)
Vps23_core 322..381 CDD:401418 40/58 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 153 1.000 Domainoid score I4274
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H4584
Inparanoid 1 1.050 363 1.000 Inparanoid score I2143
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435538at2759
OrthoFinder 1 1.000 - - FOG0001267
OrthoInspector 1 1.000 - - oto104775
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3220
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.